Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KGF-2/FGF-10, Mouse

KGF-2/FGF-10 Protein, Mouse is a paracrine signaling molecule and is involved in the branching of morphogenesis in multiple organs such as the lungs, skin, ear and salivary glands.

Product Specifications

Product Name Alternative

KGF-2/FGF-10 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kgf-2-fgf-10-protein-mouse.html

Purity

95.00

Smiles

SSAGRHVRSYNHLQGDVRWRRLFSFTKYFLTIEKNGKVSGTKNEDCPYSVLEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMTIQT

Molecular Formula

14165 (Gene_ID) O35565 (S62-T209) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Nomura S, et al. FGF10/FGFR2 signal induces cell migration and invasion in pancreatic cancer. Br J Cancer. 2008 Jul 22;99 (2) :305-13.|[2]Bagai S, et al. Fibroblast growth factor-10 is a mitogen for urothelial cells. J Biol Chem. 2002 Jun 28;277 (26) :23828-37.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TMEM80 Human siRNA Oligo Duplex (Locus ID 283232)
SR316998 1 Kit

TMEM80 Human siRNA Oligo Duplex (Locus ID 283232)

Ask
View Details
Glial Fibrillary Acidic Protein Antibody / GFAP
V9403-20UG 20 µg

Glial Fibrillary Acidic Protein Antibody / GFAP

Ask
View Details
Rat Tmem204 Pre-designed siRNA Set B
SI214762B 1 Each

Rat Tmem204 Pre-designed siRNA Set B

Ask
View Details
ADCY5 (Adenylate Cyclase Type 5, ATP Pyrophosphate-lyase 5, Adenylate Cyclase Type V, Adenylyl Cyclase 5, ADCY5) (APC) discontinued
302248-APC 100 µL

ADCY5 (Adenylate Cyclase Type 5, ATP Pyrophosphate-lyase 5, Adenylate Cyclase Type V, Adenylyl Cyclase 5, ADCY5) (APC) discontinued

Ask
View Details
(1R)-1,5-Dihydroxyempagliflozin-d4
TRC-D452717-50MG 50 mg

(1R)-1,5-Dihydroxyempagliflozin-d4

Ask
View Details