Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD28, Human/Cynomolgus/Rhesus Macaque (HEK293, C-His)

The CD28 protein is critical for T cell activation, enhancing proliferation, cytokine production, and survival. When linked to TCR/CD3 and CD40L, CD28 promotes the production of IL4 and IL10, thereby regulating immune responses. CD28 Protein, Human/Cynomolgus/Rhesus Macaque (HEK293, C-His) is the recombinant Rhesus Macaque, cynomolgus-derived CD28 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD28 Protein, Human/Cynomolgus/Rhesus Macaque (HEK293, C-His), Rhesus Macaque; Human; Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd28-protein-cynomolgus-rhesus-macaque-hek293-his.html

Purity

96.0

Smiles

NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP

Molecular Formula

940/102146670/705313 (Gene_ID) P10747-1/Q0PDN3/Q0PDN4 (N19-P152) (Accession)

Molecular Weight

Approximately 27-45 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H1 (AE-4), CF405S conjugate, 0.1mg/mL
BNC040096-500 1x 500 µL

Histone H1 (AE-4), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL
BNC740669-100 1x 100 µL

P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF640R conjugate, 0.1mg/mL
BNC400178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Carcinoembryonic Antigen (CEA) / CD66 (C66/1983R), CF405S conjugate, 0.1mg/mL
BNC041983-100 1x 100 µL

Carcinoembryonic Antigen (CEA) / CD66 (C66/1983R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD117 (KIT/983), CF488A conjugate, 0.1mg/mL
BNC880983-500 1x 500 µL

CD117 (KIT/983), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MyoD1 (MYD712), CF405S conjugate, 0.1mg/mL
BNC040712-500 1x 500 µL

MyoD1 (MYD712), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details