Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Staphylokinase, S. aureus

Staphylokinase Protein efficiently converts plasminogen into active plasmin, a key enzyme in fibrinolysis. It forms a 1:1 complex with plasmin, activating additional plasminogen molecules and amplifying the fibrinolytic cascade. Staphylokinase Protein, S. aureus is the recombinant Staphylococcus aureus-derived Staphylokinase protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

Staphylokinase Protein, S. aureus, Staphylococcus aureus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/staphylokinase.html

Purity

97.0

Smiles

SSSFDKGKYKKGDDASYFEPTGPYLMVNVTGVDGKGNELLSPHYVEFPIKPGTTLTKEKIEYYVEWALDATAYKEFRVVELDPSAKIEVTYYDKNKKKEETKSFPITEKGFVVPDLSEHIKNPGFNLITKVVIEKK

Molecular Formula

58067813 (Gene_ID) P68802 (S28-K163) (Accession)

Molecular Weight

Approximately 15.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELMSAN1 (B-10) Alexa Fluor® 546
sc-514710 AF546 200 µg/mL

ELMSAN1 (B-10) Alexa Fluor® 546

Sign In for Pricing
View Details
Fibroblast growth factor 2
AP83125 1 mg

Fibroblast growth factor 2

Sign In for Pricing
View Details
GLRX Protein Vector (Rat) (pPB-C-His)
PV270426 500 ng

GLRX Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Tyrosinase Rabbit Polyclonal Antibody (PE-Cy5.5)
orb913384 100 µL

Tyrosinase Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details
Rabbit Polyclonal PRAC Antibody [mFluor Violet 450 SE]
NBP2-97053MFV450 0.1 mL

Rabbit Polyclonal PRAC Antibody [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Pfas sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4689802 1.0 µg DNA

Pfas sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details