Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXCR4, Human (N-His-SUMO, C-Myc)

The CXCR4 protein functions as a receptor for the CXC chemokine CXCL12/SDF-1, triggering an increase in intracellular calcium ions and activation of MAPK1/MAPK3. It is actively involved in AKT signaling, which is critical for regulating cell migration, especially in wound healing. CXCR4 Protein, Human (N-His-SUMO, C-Myc) is the recombinant human-derived CXCR4 protein, expressed by E. coli , with N-10*His, C-Myc, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

CXCR4 Protein, Human (N-His-SUMO, C-Myc), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cxcr4-protein-human-his-sumo.html

Purity

90.00

Smiles

PILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSS

Molecular Formula

7852 (Gene_ID) P61073-2 (P303-S352) (Accession)

Molecular Weight

Approximately 28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Antibody to CD105
MBS8596657-01 0.1 mL

Mouse Monoclonal Antibody to CD105

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to CD105
MBS8596657-02 0.1 mL (AF405L)

Mouse Monoclonal Antibody to CD105

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to CD105
MBS8596657-03 0.1 mL (AF405S)

Mouse Monoclonal Antibody to CD105

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to CD105
MBS8596657-04 0.1 mL (AF610)

Mouse Monoclonal Antibody to CD105

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to CD105
MBS8596657-05 0.1 mL (AF635)

Mouse Monoclonal Antibody to CD105

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to CD105
MBS8596657-06 0.1 mL (APC)

Mouse Monoclonal Antibody to CD105

Sign In for Pricing
View Details