Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Epstein-Barr virus Secreted protein BARF1 (BARF1)

Product Specifications

Product Name Alternative

33 kDa early protein p33

Abbreviation

Recombinant Epstein-Barr virus BARF1 protein

Gene Name

BARF1

UniProt

P0CW72

Expression Region

21-221aa

Organism

Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4)

Target Sequence

VTAFLGERVTLTSYWRRVSLGPEIEVSWFKLGPGEEQVLIGRMHHDVIFIEWPFRGFFDIHRSANTFFLVVTAANISHDGNYLCRMKLGETEVTKQEHLSVVKPLTLSVHSERSQFPDFSVLTVTCTVNAFPHPHVQWLMPEGVEPAPTAANGGVMKEKDGSLSVAVDLSLPKPWHLPVTCVGKNDKEEAHGVYVSGYLSQ

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

Plays diverse functions in immunomodulation and oncogenicity, maybe by acting as a functional receptor for human CSF1. May inhibit interferon secretion from mononuclear cells. Exhibits oncogenic activity in vitro (By similarity) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

28.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PCSK2 (Proprotein Convertase Subtilisin/Kexin Type 2) ELISA Kit
MBS8803708-01 48 Well

Human PCSK2 (Proprotein Convertase Subtilisin/Kexin Type 2) ELISA Kit

Sign In for Pricing
View Details
Human PCSK2 (Proprotein Convertase Subtilisin/Kexin Type 2) ELISA Kit
MBS8803708-02 96 Well

Human PCSK2 (Proprotein Convertase Subtilisin/Kexin Type 2) ELISA Kit

Sign In for Pricing
View Details
Human PCSK2 (Proprotein Convertase Subtilisin/Kexin Type 2) ELISA Kit
MBS8803708-03 5x 96 Well

Human PCSK2 (Proprotein Convertase Subtilisin/Kexin Type 2) ELISA Kit

Sign In for Pricing
View Details
Human PCSK2 (Proprotein Convertase Subtilisin/Kexin Type 2) ELISA Kit
MBS8803708-04 10x 96 Well

Human PCSK2 (Proprotein Convertase Subtilisin/Kexin Type 2) ELISA Kit

Sign In for Pricing
View Details
CEP152 Antibody
ABF9041 100 µg

CEP152 Antibody

Sign In for Pricing
View Details
NovaUltra Fontana Masson Stain Kit
IW-3003 Each

NovaUltra Fontana Masson Stain Kit

Sign In for Pricing
View Details