Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HPSE, Rat (His-Myc)

HPSE proteins cleave HSPG into heparan sulfate side chains and decorin, involved in ECM degradation and remodeling. HPSE promotes cell migration associated with metastasis, wound healing, and inflammation and acts as a procoagulant. HPSE also induces AKT1/PKB phosphorylation, enhancing angiogenesis, hair follicle differentiation and homeostasis. HPSE Protein, Rat (His-Myc) is the recombinant rat-derived HPSE protein, expressed by E. coli , with N-10*His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

HPSE Protein, Rat (His-Myc), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hpse-protein-rat-his-myc.html

Purity

92.00

Smiles

KDVVDLEFYTKRLFQSVSPSFLSITIDASLATDPRFLTFLGSPRLRALARGLSPAYLRFGGTKTDFLIFDPNKE

Molecular Formula

64537 (Gene_ID) Q71RP1 (K29-E102) (Accession)

Molecular Weight

Approximately 15.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Annexin V Antibody (FITC)
GWB-22DB78 100 Tests

Annexin V Antibody (FITC)

Sign In for Pricing
View Details
ADSS2 Antibody / Adenylosuccinate synthetase isozyme 2
RQ8783 100 µL

ADSS2 Antibody / Adenylosuccinate synthetase isozyme 2

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometrium
CS601653 5x 5 µm

Frozen Tissue Sections, Endometrium

Sign In for Pricing
View Details
2- ((2-Methylpiperazin-1-yl) methyl) benzonitrile hydrochloride
OR1051492 100 mg

2- ((2-Methylpiperazin-1-yl) methyl) benzonitrile hydrochloride

Sign In for Pricing
View Details
Influenza A (H1N1, Flu A, Swine Flu, Flu A H1N1) discontinued
227008 1 mg

Influenza A (H1N1, Flu A, Swine Flu, Flu A H1N1) discontinued

Sign In for Pricing
View Details
TRPS1 antibody
70R-32191 100 ug

TRPS1 antibody

Sign In for Pricing
View Details