Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Plasmodium falciparum Plasmepsin-1

Product Specifications

Product Name Alternative

Aspartic hemoglobinase I (PfAPG)

Abbreviation

Recombinant Plasmodium falciparum Plasmepsin-1 protein

UniProt

P39898

Expression Region

125-452aa

Organism

Plasmodium falciparum

Target Sequence

AGDSVTLNDVANVMYYGEAQIGDNKQKFAFIFDTGSANLWVPSAQCNTIGCKTKNLYDSNKSKTYEKDGTKVEMNYVSGTVSGFFSKDIVTIANLSFPYKFIEVTDTNGFEPAYTLGQFDGIVGLGWKDLSIGSVDPVVVELKNQNKIEQAVFTFYLPFDDKHKGYLTIGGIEDRFYEGQLTYEKLNHDLYWQVDLDLHFGNLTVEKATAIVDSGTSSITAPTEFLNKFFEGLDVVKIPFLPLYITTCNNPKLPTLEFRSATNVYTLEPEYYLQQIFDFGISLCMVSIIPVDLNKNTFILGDPFMRKYFTVFDYDNHTVGFALAKKKL

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Participates in the digestion of the host hemoglobin. Initial cleavage at the hinge region of hemoglobin, than cleaves at other sites, leading to denaturation of the molecule and to further degradation.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

41.0 kDa

References & Citations

"Crystal structures of the free and inhibited forms of plasmepsin I (PMI) from Plasmodium falciparum." Bhaumik P., Horimoto Y., Xiao H., Miura T., Hidaka K., Kiso Y., Wlodawer A., Yada R.Y., Gustchina A. J. Struct. Biol. 175:73-84 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Moesin (MSN/492), CF405S conjugate, 0.1mg/mL
BNC040492-500 1x 500 µL

Moesin (MSN/492), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P4HB Human Gene Knockout Kit (CRISPR)
KN202275 1 Kit

P4HB Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human IgG (H&L) Antibody Biotin Conjugated Pre-Adsorbed
TA397764 2 mg

Human IgG (H&L) Antibody Biotin Conjugated Pre-Adsorbed

Sign In for Pricing
View Details
JNK1 (MAPK8) (C-term) Rabbit Polyclonal Antibody
AP14120PU-N 400 µL

JNK1 (MAPK8) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CROCCP3 Antibody (Biotin)
KB-3703-01 50 μL

CROCCP3 Antibody (Biotin)

Sign In for Pricing
View Details
CROCCP3 Antibody (Biotin)
KB-3703-02 100 µL

CROCCP3 Antibody (Biotin)

Sign In for Pricing
View Details