Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSP40/DNAJB1, Human (His)

HSP40/DNAJB1 protein, a key player in cellular processes, interacts with HSP70 to enhance ATPase activity and stimulate HSC70-HIP association. It negatively regulates HSF1 transcriptional activity in heat shock response recovery, and interacts with DNAJC3 and HSF1, inhibiting their transcriptional activity. These multifaceted interactions showcase HSP40/DNAJB1's intricate regulatory functions in stress responses and protein folding. HSP40/DNAJB1 Protein, Human (His) is the recombinant human-derived HSP40/DNAJB1 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HSP40/DNAJB1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hsp40-dnajb1-protein-human-his.html

Purity

98.0

Smiles

GKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI

Molecular Formula

3337 (Gene_ID) P25685-1 (G2-I340) (Accession)

Molecular Weight

38-41 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Endothelial nitric oxide synthase, eNOS ELISA Kit
MBS700721-01 24 Well (LIMIT 1)

Mouse Endothelial nitric oxide synthase, eNOS ELISA Kit

Sign In for Pricing
View Details
Mouse Endothelial nitric oxide synthase, eNOS ELISA Kit
MBS700721-02 48 Well

Mouse Endothelial nitric oxide synthase, eNOS ELISA Kit

Sign In for Pricing
View Details
Mouse Endothelial nitric oxide synthase, eNOS ELISA Kit
MBS700721-03 96 Well

Mouse Endothelial nitric oxide synthase, eNOS ELISA Kit

Sign In for Pricing
View Details
Mouse Endothelial nitric oxide synthase, eNOS ELISA Kit
MBS700721-04 5x 96 Well

Mouse Endothelial nitric oxide synthase, eNOS ELISA Kit

Sign In for Pricing
View Details
Mouse Endothelial nitric oxide synthase, eNOS ELISA Kit
MBS700721-05 10x 96 Well

Mouse Endothelial nitric oxide synthase, eNOS ELISA Kit

Sign In for Pricing
View Details
Human CX3CL1/Fractalkine Recombinant Protein
PROTP78423-20ug 20 µg

Human CX3CL1/Fractalkine Recombinant Protein

Sign In for Pricing
View Details