Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSP40/DNAJB1, Human (His)

HSP40/DNAJB1 protein, a key player in cellular processes, interacts with HSP70 to enhance ATPase activity and stimulate HSC70-HIP association. It negatively regulates HSF1 transcriptional activity in heat shock response recovery, and interacts with DNAJC3 and HSF1, inhibiting their transcriptional activity. These multifaceted interactions showcase HSP40/DNAJB1's intricate regulatory functions in stress responses and protein folding. HSP40/DNAJB1 Protein, Human (His) is the recombinant human-derived HSP40/DNAJB1 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HSP40/DNAJB1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hsp40-dnajb1-protein-human-his.html

Purity

98.0

Smiles

GKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI

Molecular Formula

3337 (Gene_ID) P25685-1 (G2-I340) (Accession)

Molecular Weight

38-41 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZD-4190
S6543-5mg 5 mg

ZD-4190

Sign In for Pricing
View Details
Hsa-miR-6760-3p antagomir
HY-RI02078A-01 5 nmol

Hsa-miR-6760-3p antagomir

Sign In for Pricing
View Details
Hsa-miR-6760-3p antagomir
HY-RI02078A-02 20 nmol

Hsa-miR-6760-3p antagomir

Sign In for Pricing
View Details
Human BAMBI shRNA Plasmid
abx958509-01 150 µg

Human BAMBI shRNA Plasmid

Sign In for Pricing
View Details
Human BAMBI shRNA Plasmid
abx958509-02 300 µg

Human BAMBI shRNA Plasmid

Sign In for Pricing
View Details
Rabbit Polyclonal HSPC268 Antibody
NBP2-31902 0.1 mL

Rabbit Polyclonal HSPC268 Antibody

Sign In for Pricing
View Details