Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSP40/DNAJB1, Human (His)

HSP40/DNAJB1 protein, a key player in cellular processes, interacts with HSP70 to enhance ATPase activity and stimulate HSC70-HIP association. It negatively regulates HSF1 transcriptional activity in heat shock response recovery, and interacts with DNAJC3 and HSF1, inhibiting their transcriptional activity. These multifaceted interactions showcase HSP40/DNAJB1's intricate regulatory functions in stress responses and protein folding. HSP40/DNAJB1 Protein, Human (His) is the recombinant human-derived HSP40/DNAJB1 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HSP40/DNAJB1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hsp40-dnajb1-protein-human-his.html

Purity

98.0

Smiles

GKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI

Molecular Formula

3337 (Gene_ID) P25685-1 (G2-I340) (Accession)

Molecular Weight

38-41 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRP78/Bip Recombinant Antibody, PE-Cy7 Conjugated
bsm-62645R-PE-Cy7-01 20 µL

GRP78/Bip Recombinant Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
GRP78/Bip Recombinant Antibody, PE-Cy7 Conjugated
bsm-62645R-PE-Cy7-02 100 µL

GRP78/Bip Recombinant Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
Olfr703 CRISPR/Cas9 KO Plasmid (m)
sc-434720 20 µg

Olfr703 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
MED22 Polyclonal Antibody
MBS8568532-01 0.1 mL

MED22 Polyclonal Antibody

Sign In for Pricing
View Details
MED22 Polyclonal Antibody
MBS8568532-02 0.1 mL (AF405L)

MED22 Polyclonal Antibody

Sign In for Pricing
View Details
MED22 Polyclonal Antibody
MBS8568532-03 0.1 mL (AF405S)

MED22 Polyclonal Antibody

Sign In for Pricing
View Details