Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Noggin (NOG) (Active)

Product Specifications

Product Name Alternative

Noggin; NOG

Abbreviation

Recombinant Human Noggin protein (Active)

Gene Name

Noggin

UniProt

Q13253

Expression Region

28-232aa

Organism

Homo sapiens (Human)

Target Sequence

QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC

Tag

Tag free

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Others

Endotoxin

≤10 EU/mg by the LAL method

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Determined by its ability to inhibit 5.0 ng/ml of BMP-4 induced alkaline phosphatase production by ATDC-5 chondrogenic cells. The expected ED50 for this effect is 2.0-3.0 ng/ml of Noggin.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered solution containingPBS, 5% mannitoland 0.01% Tween 80, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

23 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Ovary: left
CR560534 5 µg

Tissue Total RNA, Ovary: left

Sign In for Pricing
View Details
C20orf7 (NDUFAF5) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6A9]
TA809182AM 100 µL

C20orf7 (NDUFAF5) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6A9]

Sign In for Pricing
View Details
DMC1 (2H12/4), CF594 conjugate, 0.1mg/mL
BNC942178-100 1x 100 µL

DMC1 (2H12/4), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1373), CF740 conjugate, 0.1mg/mL
BNC741373-100 1x 100 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1373), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human HSF5 activation kit by CRISPRa
GA114845 1 Kit

Human HSF5 activation kit by CRISPRa

Sign In for Pricing
View Details
C4BPA Rabbit Polyclonal Antibody
TA372152 100 µL

C4BPA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details