Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Beta-nerve growth factor (NGF) (Active)

Product Specifications

Product Name Alternative

Beta-Nerve Growth Factor; Beta-NGF; NGF; NGFB

Abbreviation

Recombinant Human NGF protein (Active)

Gene Name

NGF

UniProt

P01138

Expression Region

122-241aa

Organism

Homo sapiens (Human)

Target Sequence

SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Human β-Nerve Growth Factor (β-NGF) was initially isolated in the mouse submandibular gland. It is composed of three non-covalently linked subunits α, β, and γ; it exhibits all the biological activities ascribed to NGF. It is structurally related to BDNF, NT-3 and NT-4 and belongs to the cysteine-knot family of growth factors that assume stable dimeric structures. Β-NGF is a neurotrophic factor that signals through its receptor β-NGF, and plays a crucial role in the development and preservation of the sensory and sympathetic nervous systems. Β-NGF also acts as a growth and differentiation factor for B lymphocytes and enhances B-cell survival. These results suggest that β-NGF is a pleiotropic cytokine, which in addition to its neurotropic activities may have an important role in the regulation of the immune system. Human β-NGF shares 90% sequence similarity with mouse protein and shows cross-species reactivity.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

The ED50 as determined in a cell proliferation assay using TF‑1 human erythroleukemic cells is 0.03-0.3 ng/ml.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, PH7.4.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades through those receptor tyrosine kinase to regulate neuronal proliferation, differentiation and survival. Inhibits metalloproteinase dependent proteolysis of platelet glycoprotein VI

Molecular Weight

13.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rhoc Mouse Pre-designed siRNA Set A
HY-RS19377 1 Set

Rhoc Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
Rabbit Anti Human F11R Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot,IHC,ELISA) 120ul
IRBAHUF11RAP338120UL 120 µL

Rabbit Anti Human F11R Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot,IHC,ELISA) 120ul

Sign In for Pricing
View Details
Rabbit Anti Human NIF3L1 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot,ELISA) 200UL
IRBAMLNIF3L1AP52200UL 200 µL

Rabbit Anti Human NIF3L1 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot,ELISA) 200UL

Sign In for Pricing
View Details
Olr1541 Protein Vector (Rat) (pPM-C-HA)
PV288504 500 ng

Olr1541 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Cronobacter sakazakii Aspartate carbamoyltransferase (pyrB)
MBS1184813-01 0.02 mg (E-Coli)

Recombinant Cronobacter sakazakii Aspartate carbamoyltransferase (pyrB)

Sign In for Pricing
View Details
Recombinant Cronobacter sakazakii Aspartate carbamoyltransferase (pyrB)
MBS1184813-02 0.02 mg (Yeast)

Recombinant Cronobacter sakazakii Aspartate carbamoyltransferase (pyrB)

Sign In for Pricing
View Details