Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF-E

A DNA sequence encoding the mature variant of ovVEGF-E isolate D1701 (Dehio et al., 1999; GenBank accession No. AF106020) was expressed in E. coli as a 132 amino acid residue fusion protein with an N-terminal His-tag sequence and a thrombin cleavage site. Recombinant VEGF-E homodimer was dimerized in vitro and has a predicted mass of approximately 35 kDa. Based on sequence similarity to VEGF-A, a gene encoding a VEGF homologue has recently been discovered in the genome of Orf virus (OV) (Lyttle et al., 1994) . Different isolates of Orf virus show significant amino acid sequence similarity to VEGF-A and described as a viral virulence factor that appears to be derived from captured host genes. All eight cysteine residues of the central cysteine knot motif characteristic of members of the VEGF family are conserved among other residues in the VEGF-E proteins (Dehio et al., 1999; Wise et al., 1999) . Alignment of all mammalian VEGF sequences indicated that VEGF-E is distinct from the previously described VEGFs but most closely related to VEGF-A. Like VEGF-A, VEGF-E was found to bind with high affinity to VEGF receptor-2 (KDR) resulting in receptor autophosphorylation, whilst in contrast to VEGF-A, VEGF-E can not bind to VEGF receptor-1 (Flt-1) . Furthermore VEGF-E can also not bind to VEGF receptor-3 (FLT-4) . Therefore VEGF-E is a potent angiogenic factor selectively binding to VEGF receptor –2/KDR.

Product Specifications

Synonyms

Vascular Endothelial Growth Factor-E

UniProt

Q9YMF3

Accession Number

AAD03735.1

Accession Number mRNA

AF106020.1

Reactivity

Orf virus

Cross Reactivity

Orf Virus

Sequence

MGSSHHHHHHSSGLVPRGSHDSTKTWSEVFENSGCKPRPMVFRVHDEHPELTSQRFNPPCVTLMRCGGCCNDESLECVPTEEANVTMQLMGASVSGGNGMQHLSFVEHKKCDCKPPLTTTPPTTTRPPRRRR

Assay Protocol

The lyophilized ovVEGF-E should be reconstituted in water or medium to a concentration not lower than 50 µg/ml. For long term storage we would recommend to add at least 0.1% human or bovine serum albumin.

Endotoxin

< 0.1 ng per µg of ov-VEGF-E

Purity

> 90% by SDS-PAGE

Bioactivity

Measured in a cell proliferation assay using primary HUVECs. The ED50 for this effect is typically 1 – 5 ng/mL.

Length

132

Form

Lyophilized

Buffer

PBS

Reconstitution

Water

Molecular Weight

35 kDa (Dimer)

Host or Source

E. coli

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC16A3/MCT 4 Antibody (YA6766, Rabbit)
HY-P87073-01 10 µL

SLC16A3/MCT 4 Antibody (YA6766, Rabbit)

Sign In for Pricing
View Details
SLC16A3/MCT 4 Antibody (YA6766, Rabbit)
HY-P87073-02 50 μL

SLC16A3/MCT 4 Antibody (YA6766, Rabbit)

Sign In for Pricing
View Details
SLC16A3/MCT 4 Antibody (YA6766, Rabbit)
HY-P87073-03 100 µL

SLC16A3/MCT 4 Antibody (YA6766, Rabbit)

Sign In for Pricing
View Details
HSP60 (P. falciparum) Antibody: ATTO 390
SPC-185D-A390 100 µg

HSP60 (P. falciparum) Antibody: ATTO 390

Sign In for Pricing
View Details
HIF-1 alpha (HIF1A) Human shRNA Plasmid Kit (Locus ID 3091)
TF320380 1 Kit

HIF-1 alpha (HIF1A) Human shRNA Plasmid Kit (Locus ID 3091)

Sign In for Pricing
View Details
Recombinant Human BIN1 Protein, N-His
orb2970030-01 50 µg

Recombinant Human BIN1 Protein, N-His

Sign In for Pricing
View Details