Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF-C152S

VEGF-C152S is a point mutant generated by the replacement of the second conserved Cys residue of the recombinant processed VEGF-C by a Ser residue. VEGF-C152S is analog to the human VEGF-C156S mutant and only active toward VEGFR-3/FLT-4 but, unlike wild type VEGF-C, is unable to bind to and to activate signalling through VEGFR-2/KDR. VEGF-C152S was inactive in the vascular permeability assay and did not increase migration of the capillary endothelial cells, indicating that these VEGF-like effects of VEGF-C require VEGFR-2 binding. VEGF-C, also known as Vascular Endothelial Growth Factor Related Protein (VRP), is a recently discovered VEGF growth factor family member that is most closely related to VEGF-D. The rat VEGF-C cDNA encodes a pre-pro-protein of 416 amino acids residues. It is almost identical to the mouse VEGF-C protein. Similar to VEGF-D, VEGF-C has a VEGF homology domain spanning the middle third of the precursor molecule and long N- and C-terminal extensions. Recombinant rat VEGF-C, lacking the N- and C-terminal extensions and containing only the middle VEGF homology domain, forms primarily non-covalently linked dimers. This protein is a ligand for both VEGFR-2/KDR and VEGFR-3/FLT-4. Since VEGFR-3 is strongly expressed in lymphatic endothelial cells, it has been postulated that VEGF-C is involved in the regulation of the growth and/or differentiation of lymphatic endothelium. Although recombinant rat VEGF-C is also a mitogen for vascular endothelial cells, it is much less potent than VEGF-A. The recombinant rat VEGF-C contains 127 amino acids residues and was fused to a His-tag (6x His) at the C-terminal end. As a result of glycosylation recombinant rat VEGF-C migrates as an 18-24 kDa protein in SDS-PAGE under reducing conditions.

Product Specifications

Synonyms

Vascular endothelial growth factor C, Vegfc, VRP, Flt4 ligand, Flt4-L

NCBI Gene ID

114111

UniProt

O35757

Accession Number

NP_446105.1

Accession Number mRNA

NM_053653.1

Chromosomal Location

16p11

Reactivity

Rat

Cross Reactivity

Rat

Label

His-Tag

Sequence

DTVKLAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKPPSVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIHHHHHH

Assay Protocol

The lyophilized VEGF-C152S is soluble in water and most aqueous buffers. The lyophilized VEGF-C152S should be reconstituted in PBS or medium to a concentration not lower than 50µg/ml.

Purity

> 90% by SDS-PAGE

Bioactivity

(A) The proliferative response to rrVEGF-CC152S was assayed in VEGFR3-expressing porcine aortic endothelial (PAE) cells (in vitro) . (B) The lymphangiogenic response to rrVEGF-CC152S loaded in a biopolymeric albumin-alginate microcapsules for targeted slow-release was assayed in male Wistar rats.

Length

127

Form

Lyophilized

Buffer

50 mM acetic acid

Additives

BSA (50-fold)

Reconstitution

PBS

Molecular Weight

18.0 - 24.0 kDa

Storage Conditions

Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted VEGF-C152S should be stored in working aliquots at -20°C. Avoid repeated freeze-thaw cycles!

Host or Source

Insect cells

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDKN1C Antibody
E036788 100 µg -100 µL

CDKN1C Antibody

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Sphingosine Kinase 1 (SPHK1)
MBS2075126-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Sphingosine Kinase 1 (SPHK1)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Sphingosine Kinase 1 (SPHK1)
MBS2075126-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Sphingosine Kinase 1 (SPHK1)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Sphingosine Kinase 1 (SPHK1)
MBS2075126-03 0.5 mL

APC/CY7-Linked Polyclonal Antibody to Sphingosine Kinase 1 (SPHK1)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Sphingosine Kinase 1 (SPHK1)
MBS2075126-04 1 mL

APC/CY7-Linked Polyclonal Antibody to Sphingosine Kinase 1 (SPHK1)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Sphingosine Kinase 1 (SPHK1)
MBS2075126-05 5 mL

APC/CY7-Linked Polyclonal Antibody to Sphingosine Kinase 1 (SPHK1)

Sign In for Pricing
View Details