Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF188

Rat Vascular Endothelial Growth Factor188 (VEGF188), a 20,07 kDa protein consisting of 188 amino acid residues, is produced as a homodimer. VEGF188 is a polypeptide growth factor and a member of the platelet-derived growth factor family. It is a specific mitogen for vascular endothelial cells and a strong angiogenic factor in vivo. Two high-affinity tyrosine kinase receptors for VEGF188 have been identified, VEGFR-1 (FLT-1), and VEGFR-2 (Flk-1) . Consistent with the endothelial cell-specific action of VEGF188, expression of both receptor genes has been found predominantly but not exclusively on endothelial cells. Expression of VEGFR-1 was also found on human monocytes, neutrophils (PMNs), bovine brain pericytes and villous and extravillous trophoblasts. In addition to its action as a mitogen it is a potent vascular permeability factor (VPF) in vivo and is also a chemo attractant for monocytes and endothelial cells. At least four different proteins are generated by differential splicing of the mouse VEGF gene: VEGF120, VEGF144, VEGF164 and VEGF188. The most abundant form is VEGF164. Whereas VEGF120, VEGF144 and VEGF164 are secreted proteins, VEGF188 is strongly cell-associated. In addition, the isoforms VEGF164 and VEGF188 bind to heparin with high affinity. All dimeric forms possess similar biological activities. A related protein of VEGF is placenta growth factor (PlGF) with about 53% homology and VEGF-B with similar biological activities. The full ORF of native rat VEGF188 (Ala27-Arg214) was cloned from total RNA of rat sinusoidal endothelial cells using standard protocols.

Product Specifications

Synonyms

Vascular endothelial growth factor A; Vegfa; Vegf; VEGF188

NCBI Gene ID

83785

UniProt

P16612

Accession Number

NP_114024.2.

Accession Number mRNA

NM_031836.2

Reactivity

Rat

Cross Reactivity

Rat

Sequence

APTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKKSVRGKGKGQKRKRKKSRFKSWSVHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Assay Protocol

The lyophilized VEGF188 should be reconstituted in ddH2O to a concentration not lower than 50µg/ml.

Purity

> 90% by SDS-PAGE

Bioactivity

Determined by the dose-dependent stimulation of the proliferation of human umbilical vein endothelial cells (HUVEC) using a concentration range of 2-10 ng/ml.

Length

188

Form

Lyophilized (freeze-dried)

Buffer

PBS

Reconstitution

Water

Molecular Weight

22.07 kDa

Storage Conditions

Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted VEGF188 should be stored in working aliquots at -20°C.

Host or Source

E. coli

N Terminal Sequence

APTTEGEQKAH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human HAO1 Pre-designed siRNA Set A
SI006898A 1 Each

Human HAO1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
TRIM34 Protein Lysate
OCOA08815-20UG 20 µg

TRIM34 Protein Lysate

Sign In for Pricing
View Details
GARS, Human (sf9, His)
HY-P74128-01 10 µg

GARS, Human (sf9, His)

Sign In for Pricing
View Details
GARS, Human (sf9, His)
HY-P74128-02 50 µg

GARS, Human (sf9, His)

Sign In for Pricing
View Details
GARS, Human (sf9, His)
HY-P74128-03 100 µg

GARS, Human (sf9, His)

Sign In for Pricing
View Details
REXO1, Control Peptide (RNA Exonuclease 1 Homolog, Elongin-A-binding Protein 1, EloA-BP1, Transcription Elongation Factor B Polypeptide 3-binding Protein 1, ELOABP1, KIAA1138, TCEB3BP1) discontinued
148419 100 µg

REXO1, Control Peptide (RNA Exonuclease 1 Homolog, Elongin-A-binding Protein 1, EloA-BP1, Transcription Elongation Factor B Polypeptide 3-binding Protein 1, ELOABP1, KIAA1138, TCEB3BP1) discontinued

Sign In for Pricing
View Details