Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF165b

Vascular endothelial growth factor-A (VEGF-A) is a potent mediator of both angiogenesis and vasculogenesis in the fetus and adult. Humans express two sets of alternately spliced isoforms of 121, 145, 165, 183, 189, and 206 amino acids. VEGF165 appears to be the most abundant and potent of the angiogenic isoform set, followed by VEGF121 and VEGF189. The anti-angiogenic or “b” set of isoforms is differentially spliced to contain six alternate amino acids at the C-terminus, and are the more highly expressed isoforms in normal adult tissue. VEGF165b, like VEGF121 but unlike most angiogenic isoforms, does not bind heparins and is therefore diffusible. VEGFs bind the type I transmembrane receptor tyrosine kinases VEGFR1 (Flt1) and VEGFR2 (Flk1/KDR) on endothelial cells. Although VEGF affinity is highest for binding to Flt1, KDR appears to be the primary mediator of VEGF angiogenic activity. The affinity of VEGF165b for KDR is similar to that of VEGF165, but VEGF165b only partially activates KDR such that the kinase regulatory site Y1054 is not phosphorylated. VEGF165b also does not bind Neuropilin-1, suggesting that the functional difference between VEGF165 and VEGF165b may be due to either the lack of Neuropilin-1 co-signaling or unique downstream signaling activated by VEGF165b. Since VEGF165b may compete with angiogenic VEGFs for KDR sites, its ectopic expression in tumors has been shown to inhibit their growth.

Product Specifications

Synonyms

Vascular endothelial growth factor A; VEGFA; VPF; VEGF; MVCD1

NCBI Gene ID

7422

UniProt

P15692-8

Accession Number

NP_001165100.1

Accession Number mRNA

NM_001171629.1

Chromosomal Location

6p12

Reactivity

Human

Cross Reactivity

Human

Sequence

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRSLTRKD

Assay Protocol

The lyophilized VEGF165 should be reconstituted in 50 mM acetic acid to a concentration not lower than 50 µg/ml. For long term storage we recommend to add at least 0.1% human or bovine serum albumin.

Endotoxin

< 0.1 ng per µg of human VEGF165b

Purity

> 90% by SDS-PAGE

Bioactivity

Measured by its binding ability in a functional ELISA: Recombinant human sKDR (Cat# S01-004) and sKDR (D7) /Fc (Cat# SFC-008) were coated to the plate (1μg/ml) and rhVEGF165 and rhVEGF165b were added. Bound VEGF165 and VEGF165b were detected by an anti-human VEGF-A antibody.

Length

165

Form

Lyophilized

Buffer

50mM acetic acid

Reconstitution

50mM acetic acid

Molecular Weight

38.2 kDa

Storage Conditions

Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted VEGF165 should be stored in working aliquots at -20°C.

Host or Source

E. coli

N Terminal Sequence

APMAEGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(S) -2- ((((9H-Fluoren-9-yl) methoxy) carbonyl) amino) -3- (1H-pyrrolo[2,3-b]pyridin-3-yl) propanoic acid
FF154979-01 250 mg

(S) -2- ((((9H-Fluoren-9-yl) methoxy) carbonyl) amino) -3- (1H-pyrrolo[2,3-b]pyridin-3-yl) propanoic acid

Sign In for Pricing
View Details
(S) -2- ((((9H-Fluoren-9-yl) methoxy) carbonyl) amino) -3- (1H-pyrrolo[2,3-b]pyridin-3-yl) propanoic acid
FF154979-02 500 mg

(S) -2- ((((9H-Fluoren-9-yl) methoxy) carbonyl) amino) -3- (1H-pyrrolo[2,3-b]pyridin-3-yl) propanoic acid

Sign In for Pricing
View Details
(S) -2- ((((9H-Fluoren-9-yl) methoxy) carbonyl) amino) -3- (1H-pyrrolo[2,3-b]pyridin-3-yl) propanoic acid
FF154979-03 1000 mg

(S) -2- ((((9H-Fluoren-9-yl) methoxy) carbonyl) amino) -3- (1H-pyrrolo[2,3-b]pyridin-3-yl) propanoic acid

Sign In for Pricing
View Details
(S) -2- ((((9H-Fluoren-9-yl) methoxy) carbonyl) amino) -3- (1H-pyrrolo[2,3-b]pyridin-3-yl) propanoic acid
FF154979-04 2000 mg

(S) -2- ((((9H-Fluoren-9-yl) methoxy) carbonyl) amino) -3- (1H-pyrrolo[2,3-b]pyridin-3-yl) propanoic acid

Sign In for Pricing
View Details
Rabbit Polyclonal RIOK2 Antibody [DyLight 594]
NBP2-97641DL594 0.1 mL

Rabbit Polyclonal RIOK2 Antibody [DyLight 594]

Sign In for Pricing
View Details
Rabbit anti-JARID1A/RBP2 Antibody, Affinity Purified
MBS3901405-01 0.002 mg

Rabbit anti-JARID1A/RBP2 Antibody, Affinity Purified

Sign In for Pricing
View Details