Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF165

Human Vascular Endothelial Growth Factor VEGF165, a 23 kDa protein consisting of 165 amino acid residues, is produced as a homodimer. VEGF is a polypeptide growth factor and a member of the platelet-derived growth factor family. It is a specific mitogen for vascular endothelial cells and a strong angiogenic factor in vivo. Two high-affinity tyrosine kinase receptors for VEGF165 have been identified, VEGFR-1 (FLT-1), and VEGFR-2 (KDR) . Consistent with the endothelial cell-specific action of VEGF165, expression of both receptor genes has been found predominantly but not exclusively on endothelial cells. Expression of VEGFR-1 was also found on human monocytes, neutrophils (PMNs), bovine brain pericytes and villous and extra villous trophoblast. In addition to its action as a mitogen it is a potent vascular permeability factor (VPF) in vivo. VEGF165 is also a chemo attractant molecule for monocytes and endothelial cells. 5 different proteins are generated by differential splicing: VEGF121, VEGF145, VEGF165, VEGF189 and VEGF206. The most abundant form is VEGF165. Whereas VEGF121 and VEGF165 are secreted proteins, VEGF145, VEGF189 and VEGF206 are strongly cell-associated. The isoforms VEGF145, VEGF165 and VEGF189 bind to heparin with high affinity. VEGF165 is apparently a homo-dimer, but preparations of VEGF165 show some heterogeneity on SDS gels, depending on the secretion of different glycosylation patterns. All dimeric forms have similar biological activities but their bioavailability is very different. There is good evidence that different cells and tissues express different VEGF isoforms. The other members of this increasing growth factor family are VEGF-B, -C, -D and -E. Another member is the Placenta growth factor PlGF.

Product Specifications

Synonyms

Vascular endothelial growth factor A; VEGFA; VPF; VEGF; MVCD1

NCBI Gene ID

7422

UniProt

P15692

Accession Number

NP_001020537.2

Accession Number mRNA

NM_001025366.2

Chromosomal Location

6p12

Reactivity

Human

Cross Reactivity

Human

Sequence

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Assay Protocol

The lyophilized VEGF165 should be reconstituted in 50 mM acetic acid to a concentration not lower than 50 µg/ml. For long term storage we recommend to add at least 0.1% human or bovine serum albumin.

Endotoxin

< 0.1 ng per µg of human VEGF165

Purity

> 90% by SDS-PAGE

Bioactivity

The ED50 for stimulation of cell proliferation in human umbilical vein endothelial cells by VEGF165 has been determined to be in the range of 1-5 ng/ml.

Length

165

Form

Lyophilized

Buffer

50mM acetic acid

Reconstitution

50mM acetic acid

Molecular Weight

38.2 kDa

Storage Conditions

Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted VEGF165 should be stored in working aliquots at -20°C.

Host or Source

E. coli

N Terminal Sequence

APMAEGG

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal NUCKS1 Antibody [Alexa Fluor 647]
NB100-74634AF647 0.1 mL

Rabbit Polyclonal NUCKS1 Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
Human CNOT10 Pre-designed siRNA Set A
SI003324A 1 Each

Human CNOT10 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Rabbit Polyclonal VKORC1 Antibody [PerCP]
NBP2-81859PCP 0.1 mL

Rabbit Polyclonal VKORC1 Antibody [PerCP]

Sign In for Pricing
View Details
ZBTB16, phosphorylated (Tyr334) (Zinc Finger And BTB Domain-containing Protein 16, Zinc Finger Protein PLZF, Promyelocytic Leukemia Zinc Finger Protein, Zinc Finger Protein 145, ZBTB16, PLZF, ZNF145) (PE)
Z0744-35-PE 200 µL

ZBTB16, phosphorylated (Tyr334) (Zinc Finger And BTB Domain-containing Protein 16, Zinc Finger Protein PLZF, Promyelocytic Leukemia Zinc Finger Protein, Zinc Finger Protein 145, ZBTB16, PLZF, ZNF145) (PE)

Sign In for Pricing
View Details
Rabbit Monoclonal INSM1 Antibody (INSM1/7992R) [DyLight 594]
NBP3-21090DL594 0.1 mL

Rabbit Monoclonal INSM1 Antibody (INSM1/7992R) [DyLight 594]

Sign In for Pricing
View Details
beta-actin Monoclonal Antibody
MBS2533762-01 0.03 mL

beta-actin Monoclonal Antibody

Sign In for Pricing
View Details