Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCF

Stem Cell Factor (SCF), a 18.4 kDa protein consisting of 164 amino acid residues (Asp26-Ala189) and fused to a C-terminal His-tag (6x His), is a hematopoietic growth factor that exerts its activity at the early stages of hematopoiesis. SCF stimulates the proliferation of myeloid, erythroid, and lymphoid progenitors in bone marrow cultures and has been shown to act synergistically with colony stimulating factors. This pleiotropic cytokine, alternately known as mast cell growth factor (MGF) and steel-factor (SLF), plays essential roles in gametogenesis, melanogenesis and early stages of hematopoiesis. In vitro and in vivo, SCF can stimulate the proliferation of mature, as well as the proliferation and maturation of immature, mast cells. On purified primitive human and mouse hematopoietic precursors, SCF acts in a synergistic manner with various growth factors, such as IL-1, IL-3, IL-6, IL-7, and Epo , to induce myeloid, erythroid and lymphoid lineage colony formation. The finding that SCF is also expressed in the nervous system suggests a possible role for SCF in the development of the nervous system. The cDNA sequences for human, mouse and rat SCF encode transmembrane proteins which are composed of a signal peptide, a 189 amino acid extracellular domain, a hydrophobic transmembrane domain and an intracellular domain. Native SCF can exist either as the membrane bound form or as a soluble form consisting of the first 164 or 165 amino acids of the extracellular domain. The soluble form is believed to be a proteolytic cleavage product of the transmembrane protein. Both the soluble and the transmembrane form of SCF have growth factor activities. Native soluble SCF is a heavily N- and O-glycosylated protein which exists as a non-covalently associated dimer in solution. All four cysteine residues of SCF monomers are involved in intramolecular disulfide bonds. Murine or rat soluble SCF is highly homologous to human soluble SCF (approximately 80%) . Whereas both rat and mouse SCF are active on human cells, the human protein is much less active on mouse or rat cells.

Product Specifications

Synonyms

KITLG; SF; MGF; SCF; FPH2; KL-1; Kitl; SHEP7; kit-ligand

NCBI Gene ID

4254

UniProt

P21583

Accession Number

NP_000890

Accession Number mRNA

NM_000899

Chromosomal Location

12q22

Reactivity

Human

Cross Reactivity

Human

Label

His-Tag

Sequence

EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVAASRHHHHHH

Assay Protocol

Centrifuge vial prior to opening. Human SCF should be reconstituted in water to a concentration of 0.1 mg/ml. This solution can be diluted in water or other buffer solutions or stored at -20°C.

Purity

> 98% by SDS-PAGE

Bioactivity

Measured in a cell proliferation assay using TF 1 human erythroleukemic cells [Kitamura T et al, J Cell Physiol, 1989]. The ED50 for this effect is typically 1‑5 ng/mL. .

Length

173

Form

Lyophilized

Buffer

PBS

Reconstitution

Water

Molecular Weight

20.0 - 23.0 kDa

Storage Conditions

The lyophilized human SCF, though stable at room temperature, is best stored desiccated below 0°C. Reconstituted human SCF should be stored in working aliquots at -20°C. Avoid repeated freeze-thaw cycles.

Host or Source

Insect cells

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

A4galt sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6787708 1.0 µg DNA

A4galt sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
SNX4 Polyclonal Antibody, Cy7 Conjugated
bs-12406R-Cy7 100 µL

SNX4 Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
Recombinant Human Septin-7
MBS1326642-01 0.02 mg (E-Coli)

Recombinant Human Septin-7

Sign In for Pricing
View Details
Recombinant Human Septin-7
MBS1326642-02 0.1 mg (E-Coli)

Recombinant Human Septin-7

Sign In for Pricing
View Details
Recombinant Human Septin-7
MBS1326642-03 1 mg (E-Coli)

Recombinant Human Septin-7

Sign In for Pricing
View Details
Recombinant Human Septin-7
MBS1326642-04 5x 1 mg (E-Coli)

Recombinant Human Septin-7

Sign In for Pricing
View Details