Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCF

Stem cell factor (SCF), also known as ckit ligand (KL), mast cell growth factor (MGF), and steel factor (SLF), is a widely expressed 28-40 kDa type I transmembrane glycoprotein. It promotes the survival, differentiation, and mobilization of multiple cell types including myeloid, erythroid, megakaryocytic, lymphoid, germ cell, and melanocyte progenitors. SCF is a primary growth and activation factor for mast cells and eosinophils. Mature mouse SCF consists of a 189 amino acid (aa) extracellular domain (ECD), a 23 aa transmembrane segment, and a 36 aa cytoplasmic tail. Proteolytic cleavage at two alternate sites in the extracellular juxtamembrane region releases a 25 kDa soluble. An alternately spliced isoform of mouse SCF lacks 28 aa that encompasses the primary proteolytic recognition site. Within the ECD of the short isoform, mouse SCF shares 93% aa sequence identity with rat SCF and 72%-75% with canine, feline, and human SCF. Rat SCF is active on mouse and human cells, but human SCF is only weakly active on mouse cells. Noncovalent dimers of transmembrane or soluble SCF interact with the receptor tyrosine kinase SCF R/ckit to trigger receptor dimerization and signaling.

Product Specifications

Synonyms

Kitl; Gb; SF; Sl; Clo; Con; Mgf; SCF; SLF; Kitlg; contrasted; mSCF

NCBI Gene ID

17311

UniProt

P20826

Accession Number

NP_038626.1

Accession Number mRNA

NM_013598.2

Chromosomal Location

10 D1; 10 57.0 cM

Reactivity

Mouse

Cross Reactivity

Mouse

Sequence

MKEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA

Assay Protocol

Centrifuge vial prior to opening. Mouse SCF should be reconstituted in 50mM acetic acid or water to a concentration of 0.1 mg/ml. This solution can be diluted in water or other buffer solutions or stored at -20°C.

Endotoxin

< 0.1 ng per µg of mSCF

Purity

> 95% by SDS-PAGE

Bioactivity

The ED50 as determined by the dose-dependent stimulation of the proliferation of the human TF-1 cell line is in the range of 2-10 ng/ml.

Length

165

Form

Lyophilized

Buffer

50 mM aceetic acid

Reconstitution

50 mM aceetic acid

Molecular Weight

18.42 kDa

Storage Conditions

The lyophilized mouse SCF is best stored desiccated below 0°C. Freeze/thaw cycles will result in significant loss of activity. Avoid repeated freeze-thaw cycles.

Host or Source

E. coli

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-EGFR (Tyr998) Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb1588265 100 µL

Phospho-EGFR (Tyr998) Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
Otub1 (NM_134150) Mouse Tagged ORF Clone Lentiviral Particle
MR203606L4V 200 µL

Otub1 (NM_134150) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CP2F1 Rabbit Polyclonal Antibody
MBS9514020-01 0.05 mL

CP2F1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CP2F1 Rabbit Polyclonal Antibody
MBS9514020-02 0.1 mL

CP2F1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CP2F1 Rabbit Polyclonal Antibody
MBS9514020-03 5x 0.1 mL

CP2F1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SYCP2 Rabbit Polyclonal Antibody
54140-01 50 µL

SYCP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details