Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prolactin antagonist (G129R)

Recombinant ovine prolactin, G129R mutein is one polypeptide chain containing 199 amino and an additional Ala at N-terminus acids and having a molecular mass of ~ 23 kDa, was purified by proprietary chromatographic techniques (no published information) . It is available in two forms: as full size protein and it its DEL 9 aa truncated form from its N-terminus which has higher inhibitory activity.

Product Specifications

Synonyms

Mammotropin, Luterotropic hormone, Lutetropin

NCBI Gene ID

443317

UniProt

P01240

Accession Number

NP_001009306.1

Accession Number mRNA

NM_001009306.1

Reactivity

Ovine

Cross Reactivity

Ovine

Sequence

ATPVCPNGPGNCQVSLRDLFDRAVMVSHYIHNLSSEMFNEFDKRYAQGKGFITMALNSCHTSSLPTPEDKEQAQQTHHEVLMSLILGLLRSWNDPLYHLVTEVRGMKGVPDAILSRAIEIEEENKRLLERMEMIFGQVIPGAKETEPYPVWSGLPSLQTKDEDARHSAFYNLLHCLRRDSSKIDTYLKLLNCRIIYNNNC

Assay Protocol

It is recommended to reconstitute the lyophilized oPRL G129R in sterile water or 0.4% NaHCO3 adjusted tp pH 8-9, not less than 100µg/ml, which can then be further diluted to other aqueous solutions, preferably in presence of carrier protein.

Endotoxin

< 0.1 ng/µg of protein (< 1EU/µg)

Purity

> 99% by SDS-PAGE & HPLC analyses

Bioactivity

Recombinant oPRL G129R is devoid of agonistic activity and capable of inhibiting biological activity of oPRL or other lactogenic hormones as evidenced by proliferation assay of Nb2 or other cells. The truncated form is more potent inhibitor.

Length

199

Form

Lyophilized

Reconstitution

Water

Molecular Weight

23.0 kDa

Host or Source

E. coli

N Terminal Sequence

ATPVCP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-TrkB (Y817) Recombinant Rabbit monoclonal Antibody [SC0556]
ET1610-35-50UL 50 µL

Phospho-TrkB (Y817) Recombinant Rabbit monoclonal Antibody [SC0556]

Sign In for Pricing
View Details
Aurora B (Aurora Kinase B, Serine/Threonine-protein Kinase Aurora-B, Aurora- and IPL1-like Midbody-associated protein 1, Serine/threonine-protein Kinase 12, Aurora/IPL1-related Kinase 2, AIM-1, Aurora-related kinase 2, ARK-2, STK-1, AURKB, AIK2, AIM1, ARK
MBS6151365-01 0.1 mL

Aurora B (Aurora Kinase B, Serine/Threonine-protein Kinase Aurora-B, Aurora- and IPL1-like Midbody-associated protein 1, Serine/threonine-protein Kinase 12, Aurora/IPL1-related Kinase 2, AIM-1, Aurora-related kinase 2, ARK-2, STK-1, AURKB, AIK2, AIM1, ARK

Sign In for Pricing
View Details
Aurora B (Aurora Kinase B, Serine/Threonine-protein Kinase Aurora-B, Aurora- and IPL1-like Midbody-associated protein 1, Serine/threonine-protein Kinase 12, Aurora/IPL1-related Kinase 2, AIM-1, Aurora-related kinase 2, ARK-2, STK-1, AURKB, AIK2, AIM1, ARK
MBS6151365-02 5x 0.1 mL

Aurora B (Aurora Kinase B, Serine/Threonine-protein Kinase Aurora-B, Aurora- and IPL1-like Midbody-associated protein 1, Serine/threonine-protein Kinase 12, Aurora/IPL1-related Kinase 2, AIM-1, Aurora-related kinase 2, ARK-2, STK-1, AURKB, AIK2, AIM1, ARK

Sign In for Pricing
View Details
USP17L2 Blocking Peptide
33R-3136 0.1 mg

USP17L2 Blocking Peptide

Sign In for Pricing
View Details
MXD3, NT (MXD3, BHLHC13, MAD3, Max dimerization protein 3, Class C basic helix-loop-helix protein 13, Max-associated protein 3, Max-interacting transcriptional repressor MAD3, Myx)
MBS644285-01 0.2 mL

MXD3, NT (MXD3, BHLHC13, MAD3, Max dimerization protein 3, Class C basic helix-loop-helix protein 13, Max-associated protein 3, Max-interacting transcriptional repressor MAD3, Myx)

Sign In for Pricing
View Details
MXD3, NT (MXD3, BHLHC13, MAD3, Max dimerization protein 3, Class C basic helix-loop-helix protein 13, Max-associated protein 3, Max-interacting transcriptional repressor MAD3, Myx)
MBS644285-02 5x 0.2 mL

MXD3, NT (MXD3, BHLHC13, MAD3, Max dimerization protein 3, Class C basic helix-loop-helix protein 13, Max-associated protein 3, Max-interacting transcriptional repressor MAD3, Myx)

Sign In for Pricing
View Details