Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prolactin Receptor, soluble

Prolactin is a pituitary hormone involved in the stimulation of milk production, salt and water regulation, growth, development and reproduction. The initial step in its action is the binding to a specific membrane receptor (prolactin receptor) which belongs to the superfamily of class 1 cytokine receptors. Prolactin (PRL) is a hormone involved in a variety of important functions including ion transport and osmoregulation, stimulation of milk, protein synthesis as well as the regulation of numerous reproductive functions. PRL exerts its influence on different cell types through a signal transduction pathway which begins with the binding of the hormone to a transmembrane PRL receptor. PRL receptor, varies in size (short and long forms) with tissue source and species, from ~40 kDa to 100 kDa. The PRL receptor consists of at least three separate domains: an extracellular region with 5 cysteines which contains the prolactin binding site, a single transmembrane domain and a cytoplasmic region, the length of which appears to influence ligand binding and regulate cellular function. Recombinant human Prolactin Receptor Extra Cellular Domain (rbPRLR-ECD) produced in E.Coli is a non-glycosylated, polypeptide chain containing 210 amino acids and having a molecular mass of 23972 Da was prepared like the rabbit PRLR-ECD according to Bignon et al. (1994) JBC 269; 3318-24 and tested according to Gertler et al. (1996) JBC 271; 24482-91.

Product Specifications

Synonyms

Mammotropin, Luterotropic hormone, Lutetropin

NCBI Gene ID

5618

UniProt

P16471

Accession Number

NP_000940.1

Accession Number mRNA

NM_000949.7

Reactivity

Human

Cross Reactivity

Rat, Human

Sequence

AGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFTMNDTTV

Assay Protocol

It is recommended to reconstitute the lyophilized PRLR-ECD in sterile 18M-cm H2O not less than 100µg/ml and not more than 1 mg/ml, which can then be further diluted to other aqueous solutions.

Endotoxin

< 0.1 ng/µg of protein (< 1EU/µg)

Purity

> 97% by SDS-PAGE & HPLC analyses

Bioactivity

Activity is determined by the dose-dependant inhibition of PRL-stimuled proliferation of Nb2 cells and by high affinity binding of PRL and other lactogenic hormones in 1:1 molar ratio.

Length

210

Form

Lyophilized

Reconstitution

Water

Molecular Weight

23.9 kDa

Host or Source

E. coli

N Terminal Sequence

AGKPEI

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Apolipoprotein F  (1D5)
YF-MA10047 100 ug

Anti-Apolipoprotein F (1D5)

Sign In for Pricing
View Details
Human TPM1 ELISA Kit
E039576 1 Each

Human TPM1 ELISA Kit

Sign In for Pricing
View Details
RPSAP14 Recombinant Protein (Human)
RP095313 100 µg

RPSAP14 Recombinant Protein (Human)

Sign In for Pricing
View Details
Anti-inflammatory agent 55
MBS5821282 Inquire

Anti-inflammatory agent 55

Sign In for Pricing
View Details
ELISA Kit for Mucin 1 (MUC1)
TRV-0038071-01 24 Tests

ELISA Kit for Mucin 1 (MUC1)

Sign In for Pricing
View Details
ELISA Kit for Mucin 1 (MUC1)
TRV-0038071-02 48 Tests

ELISA Kit for Mucin 1 (MUC1)

Sign In for Pricing
View Details