Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PlGF-2

Human Placenta Growth Factor-2 (PlGF-2), a 22 kDa protein consisting of 152 amino acid residues is produced as a homodimer. PlGF is a polypeptide growth factor and a member of the platelet-derived growth factor family but more related to vascular endothelial growth factor (VEGF) . PlGF acts only as a weak mitogen for those cell types possessing receptors for binding (e.g. vascular endothelial cells) . At least one high-affinity receptor for PlGF (FLT-1 or VEGF-R1) has been demonstrated in different primary cell types (e.g. human umbilical vein endothelial cells and monocytes) . In addition to its action as a weak mitogen it is also a chemoattractant for monocytes and endothelial cells. Two different proteins are generated by differential splicing of the human PlGF gene: PlGF-1 (131 aa native chain) and PlGF-2 (152 aa native chain) . Both mitogens are secretable proteins, but PlGF-2 can bind to heparin with high affinity. PlGF is apparently a homodimer, but preparations of PlGF show some heterogeneity on SDS gels depending of the varying degrees of glycosylation. All dimeric forms posses similar biologcal activities. If PlGF is angiogenic in vivo is not clear. However, heterodimers between VEGF and PlGF are mitogenic for endothelial cells and have strong angiogenic activity in vivo (e.g. in the CAM assay or in the cornea pocket assay) . Different cells and tissues (e.g. placenta) express PlGF-1 and PlGF-2 at different rates. A much related protein of PlGF is VEGF with about 53% homology and VEGF-B with similar biological activities.

Product Specifications

Synonyms

PlGF; placental growth factor

NCBI Gene ID

5228

UniProt

P49763-3

Accession Number

NP_001193941.1

Accession Number mRNA

NM_001207012.1

Chromosomal Location

2p21-p16

Reactivity

Human

Cross Reactivity

Human

Sequence

LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR

Assay Protocol

Centrifuge vial prior to opening. The PlGF-2 is supplied in lyophilized form with carrier-protein (BSA) and can be reconstituted with 50mM acetic acid or PBS/water. This solution can be diluted into other buffered solutions or stored frozen for future use.

Purity

> 95% by SDS-PAGE

Bioactivity

Measured by its ability to bind to immobilized rh-sFlt-1 in a functional ELISA. Recombinant human PlGF-2 can bind to immobilized rh-sFlt-1 (100 ng/well) with a linear range at 0.5 - 10 ng/mL.

Length

152

Form

Lyophilized

Buffer

50mM acetic acid

Additives

BSA (50-fold)

Reconstitution

50 mM acetic acid

Molecular Weight

~45.0 kDa

Storage Conditions

The lyophilized human PIGF-2, though stable at room temperature, is best stored in working aliquots at -20°C to -70°C

Host or Source

Insect cells

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fam172a sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6054407 1.0 µg DNA

Fam172a sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
LIMS3L siRNA (Human)
MBS8239042-01 15 nmol

LIMS3L siRNA (Human)

Sign In for Pricing
View Details
LIMS3L siRNA (Human)
MBS8239042-02 30 nmol

LIMS3L siRNA (Human)

Sign In for Pricing
View Details
LIMS3L siRNA (Human)
MBS8239042-03 5x 30 nmol

LIMS3L siRNA (Human)

Sign In for Pricing
View Details
Recombinant Clostridium Perfringens speE Protein (aa 1-283)
VAng-Lsx01203-500gEcoli 500 µg (E. coli)

Recombinant Clostridium Perfringens speE Protein (aa 1-283)

Sign In for Pricing
View Details
ZD-6888 Hydrochloride
BUP13798-01 5 mg

ZD-6888 Hydrochloride

Sign In for Pricing
View Details