Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PlGF-1

Human Placenta Growth Factor-1 (PlGF-1), a 19 kDa protein consisting of 131 amino acid residues is produced as a homodimer. Human Placenta Growth Factor (PlGF) is a polypeptide growth factor and a member of the platelet-derived growth factor family but more related to vascular endothelial growth factor (VEGF) . PlGF-1 acts only as a very weak mitogen for some endothelial cell types and as a potent chemoattractant for monocytes. The physiological function in vivo is still controversial. In several reports it was shown not to be a potent mitogen for endothelial cells and not angiogenic in vivo by using different assays. Very recently it was shown by one investigator, that PlGF-1 from cell culture supernatants was angiogenic in the CAM assay and in the rabbit cornea assay. At least one high-affinity receptor for PlGF (FLT-1 or VEGF-R1) has been demonstrated in different primary cell types (e.g. human umbilical vein endothelial cells and monocytes) but PlGF does not bind to KDR/flk-1. Two different proteins can be generated by differential splicing of the human PlGF gene: PlGF-1 (131 aa native chain) and PlGF-2 (152 aa native chain) . Both mitogens are secretable proteins, but PlGF-2 can bind to heparin with high affinity. PlGF-1 is a homodimer, but preparations of PlGF show some heterogeneity on SDS gels depending of the varying degrees of glycosylation. All dimeric forms posses a similar biological profile. There is good evidence that heterodimeric molecules between VEGF and PlGF exists and that they are biological active. Different cells and tissues (e.g. placenta) express PlGF-1 and PlGF-2 at different rates. A very related protein of PlGF is VEGF with about 53% homology and VEGF-B with similar biological activities.

Product Specifications

Synonyms

PlGF; placental growth factor

NCBI Gene ID

5228

UniProt

P49763

Accession Number

NP_001193941.1

Accession Number mRNA

NM_001207012.1

Chromosomal Location

2p21-p16

Reactivity

Human

Cross Reactivity

Human

Sequence

LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERCGDAVPRR

Assay Protocol

Centrifuge vial prior to opening. The PlGF-1 is supplied in lyophilized form with carrier-protein (BSA) and can be reconstituted with 50mM acetic acid or PBS/water. This solution can be diluted into other buffered solutions or stored frozen for future use.

Purity

> 95% by SDS-PAGE

Bioactivity

Measured by its ability to bind to immobilized rh-sFlt-1 in a functional ELISA. Recombinant human PlGF-1 can bind to immobilized rh-sFlt-1 (100ng/well) with a linear range at 0.5 - 10ng/ml.

Length

131

Form

Lyophilized

Buffer

50mM acetic acid

Additives

BSA (50-fold)

Reconstitution

50 mM acetic acid

Molecular Weight

~ 34.0 kDa

Storage Conditions

The lyophilized human PlGF-1, though stable at room temperature, is best stored in working aliquots at -20°C to -70°C. Avoid repeated freeze-thaw cycles.

Host or Source

Insect cells

More Discoveries

Explore Other Products

Browse additional items from our catalog

SDC3 ELISA Kit (Human) (OKCA02150)
OKCA02150 96 Well

SDC3 ELISA Kit (Human) (OKCA02150)

Sign In for Pricing
View Details
KRT83 (Keratin, Type II Cuticular Hb3, Type II Hair Keratin Hb3, Keratin-83, K83, Hair Keratin K2.10, KRTHB3, MGC141663)
128967 50 µg

KRT83 (Keratin, Type II Cuticular Hb3, Type II Hair Keratin Hb3, Keratin-83, K83, Hair Keratin K2.10, KRTHB3, MGC141663)

Sign In for Pricing
View Details
FAM71C sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
20093111 3x 1.0 µg

FAM71C sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Rabbit Polyclonal Bag-1 Antibody
NB100-56082SS 0.025 mL

Rabbit Polyclonal Bag-1 Antibody

Sign In for Pricing
View Details
UBE2K, NT (UBE2K, HIP2, LIG, Ubiquitin-conjugating enzyme E2 K, Huntingtin-interacting protein 2, Ubiquitin carrier protein, Ubiquitin-conjugating enzyme E2-25kD, Ubiquitin-protein ligase) (Azide free) (HRP) discontinued
043523-HRP 200 µL

UBE2K, NT (UBE2K, HIP2, LIG, Ubiquitin-conjugating enzyme E2 K, Huntingtin-interacting protein 2, Ubiquitin carrier protein, Ubiquitin-conjugating enzyme E2-25kD, Ubiquitin-protein ligase) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Sheep Tropomyosin Alpha 1 chain (TPM1) ELISA Kit
GTR10358392 96 Well

Sheep Tropomyosin Alpha 1 chain (TPM1) ELISA Kit

Sign In for Pricing
View Details