Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PlGF-1

Human Placenta Growth Factor-1 (PlGF-1), a 19 kDa protein consisting of 131 amino acid residues is produced as a homodimer. Human Placenta Growth Factor (PlGF) is a polypeptide growth factor and a member of the platelet-derived growth factor family but more related to vascular endothelial growth factor (VEGF) . PlGF-1 acts only as a very weak mitogen for some endothelial cell types and as a potent chemoattractant for monocytes. The physiological function in vivo is still controversial. In several reports it was shown not to be a potent mitogen for endothelial cells and not angiogenic in vivo by using different assays. Very recently it was shown by one investigator, that PlGF-1 from cell culture supernatants was angiogenic in the CAM assay and in the rabbit cornea assay. At least one high-affinity receptor for PlGF (FLT-1 or VEGF-R1) has been demonstrated in different primary cell types (e.g. human umbilical vein endothelial cells and monocytes) but PlGF does not bind to KDR/flk-1. Two different proteins can be generated by differential splicing of the human PlGF gene: PlGF-1 (131 aa native chain) and PlGF-2 (152 aa native chain) . Both mitogens are secretable proteins, but PlGF-2 can bind to heparin with high affinity. PlGF-1 is a homodimer, but preparations of PlGF show some heterogeneity on SDS gels depending of the varying degrees of glycosylation. All dimeric forms posses a similar biological profile. There is good evidence that heterodimeric molecules between VEGF and PlGF exists and that they are biological active. Different cells and tissues (e.g. placenta) express PlGF-1 and PlGF-2 at different rates. A very related protein of PlGF is VEGF with about 53% homology and VEGF-B with similar biological activities.

Product Specifications

Synonyms

PlGF; placental growth factor

NCBI Gene ID

5228

UniProt

P49763

Accession Number

NP_001193941.1

Accession Number mRNA

NM_001207012.1

Chromosomal Location

2p21-p16

Reactivity

Human

Cross Reactivity

Human

Sequence

LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERCGDAVPRR

Assay Protocol

Centrifuge vial prior to opening. The PlGF-1 is supplied in lyophilized form with carrier-protein (BSA) and can be reconstituted with 50mM acetic acid or PBS/water. This solution can be diluted into other buffered solutions or stored frozen for future use.

Purity

> 95% by SDS-PAGE

Bioactivity

Measured by its ability to bind to immobilized rh-sFlt-1 in a functional ELISA. Recombinant human PlGF-1 can bind to immobilized rh-sFlt-1 (100ng/well) with a linear range at 0.5 - 10ng/ml.

Length

131

Form

Lyophilized

Buffer

50mM acetic acid

Additives

BSA (50-fold)

Reconstitution

50 mM acetic acid

Molecular Weight

~ 34.0 kDa

Storage Conditions

The lyophilized human PlGF-1, though stable at room temperature, is best stored in working aliquots at -20°C to -70°C. Avoid repeated freeze-thaw cycles.

Host or Source

Insect cells

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Myeloperoxidase (MPO) ELISA Kit
abx155853-01 96 Tests

Rat Myeloperoxidase (MPO) ELISA Kit

Sign In for Pricing
View Details
Rat Myeloperoxidase (MPO) ELISA Kit
abx155853-02 5x 96 Tests

Rat Myeloperoxidase (MPO) ELISA Kit

Sign In for Pricing
View Details
Rat Myeloperoxidase (MPO) ELISA Kit
abx155853-03 10x 96 Tests

Rat Myeloperoxidase (MPO) ELISA Kit

Sign In for Pricing
View Details
VDR, ID (VDR, NR1I1, Vitamin D3 receptor, 1,25-dihydroxyvitamin D3 receptor, Nuclear receptor subfamily 1 group I member 1) (PE)
MBS6362421-01 0.2 mL

VDR, ID (VDR, NR1I1, Vitamin D3 receptor, 1,25-dihydroxyvitamin D3 receptor, Nuclear receptor subfamily 1 group I member 1) (PE)

Sign In for Pricing
View Details
VDR, ID (VDR, NR1I1, Vitamin D3 receptor, 1,25-dihydroxyvitamin D3 receptor, Nuclear receptor subfamily 1 group I member 1) (PE)
MBS6362421-02 5x 0.2 mL

VDR, ID (VDR, NR1I1, Vitamin D3 receptor, 1,25-dihydroxyvitamin D3 receptor, Nuclear receptor subfamily 1 group I member 1) (PE)

Sign In for Pricing
View Details
ZFP90 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV661190 1.0 µg DNA

ZFP90 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details