Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PlGF

Placenta growth factor (PlGF) is a member of the PDGF/VEGF family of growth factors that share a conserved pattern of eight cysteines. Alternate splicing results in at least three human mature PlGF forms containing 131 (PlGF-1), 152 (PlGF-2), and 203 (PlGF-3) amino acids (aa) respectively. Only PlGF-2 contains a highly basic heparin-binding 21 aa insert at the C-terminus. In rat only one PlGF that is the equivalent of human PlGF-2 has been identified. Rat PlGF shares 60%, 92%, 62% and 59% aa identity with the appropriate isoform of human, mouse, canine and equine PlGF. PlGF is mainly found as variably glycosylated, secreted, 55 - 60 kDa disulfide linked homodimers. Mammalian cells expressing PlGF include villous trophoblasts, decidual cells, erythroblasts, keratinocytes and some endothelial cells. Circulating PlGF increases during human pregnancy, reaching a peak in mid-gestation; this increase is attenuated in preeclampsia. However, deletion of PlGF in the mouse does not affect development or reproduction. Postnatally, mice lacking PlGF show impaired angiogenesis in response to ischemia. PlGF binds and signals through VEGF R1/Flt-1, but not VEGF R2/Flk-1/KDR, while VEGF binds both but signals only through the angiogenic receptor, VEGF R2. PlGF and VEGF therefore compete for binding to VEGF R1, allowing high PlGF to discourage VEGF/VEGF R1 binding and promote VEGF/VEGF R2-mediated angiogenesis. However, PlGF (especially human PlGF-1) and some forms of VEGF can form dimers that decrease the angiogenic effect of VEGF on VEGF R2. PlGF-2, like VEGF164/165, shows heparin-dependent binding of neuropilin (Npn) -1 and Npn-2 and can inhibit nerve growth cone collapse. PlGF induces monocyte activation, migration, and production of inflammatory cytokines and VEGF. These activities facilitate wound and bone fracture healing, but also contribute to inflammation in active sickle cell disease and atherosclerosis. Circulating PlGF often correlates with tumor stage and aggressiveness, and therapeutic PlGF antibodies are being investigated to inhibit tumor growth and angiogenesis.

Product Specifications

Synonyms

Pgf; Plgf; placental growth factor

NCBI Gene ID

94203

UniProt

Q63434

Accession Number

NP_446047.1

Accession Number mRNA

NM_053595

Chromosomal Location

6q31

Reactivity

Rat

Cross Reactivity

Rat

Sequence

ALSAGNNSTEMEVVPFNEVWGRSYCRPMEKLVYIADEHPNEVSHIFSPSCVLLSRCSGCCGDEGLHCVALKTANITMQILKIPPNRDPHSYVEMTFSQDVLCECRPILETTKAERRKTKGKRKQSKTPQTEEPHL

Assay Protocol

Centrifuge vial prior to opening. The rat PlGF is supplied in lyophilized form and can be reconstituted with water. This solution can be diluted into other buffered solutions or stored frozen for future use.

Purity

> 95% by SDS-PAGE

Bioactivity

Measured by its ability to bind to immobilized rh-sFlt-1 in a functional ELISA. Recombinant rat PlGF can bind to immobilized rh-sFlt-1 (100ng/well) with a linear range at 0.1 - 5ng/mL

Length

135

Form

Lyophilized (freeze-dried)

Buffer

25 mM Tris, pH 8.5

Reconstitution

Water

Molecular Weight

15.14 kDa

Storage Conditions

The lyophilized rat PIGF, though stable at room temperature, is best stored in working aliquots at -20°C to -70°C.

Host or Source

Insect cells

N Terminal Sequence

ALSAGNNSTEMEV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDX60L, CT (DDX60L, Probable ATP-dependent RNA helicase DDX60-like, DEAD box protein 60-like) (MaxLight 550) discontinued
034565-ML550 100 µL

DDX60L, CT (DDX60L, Probable ATP-dependent RNA helicase DDX60-like, DEAD box protein 60-like) (MaxLight 550) discontinued

Sign In for Pricing
View Details
KRT8P25 Recombinant Protein (Human)
RP067407 100 µg

KRT8P25 Recombinant Protein (Human)

Sign In for Pricing
View Details
GAP43 (Phospho-Ser41) Antibody
orb14962-01 50 μL

GAP43 (Phospho-Ser41) Antibody

Sign In for Pricing
View Details
GAP43 (Phospho-Ser41) Antibody
orb14962-02 100 µL

GAP43 (Phospho-Ser41) Antibody

Sign In for Pricing
View Details
NDRG2 293 Cell Lysate
403358 0.1 mg

NDRG2 293 Cell Lysate

Sign In for Pricing
View Details
PCMV-GSTM4 (human) -3xHA-Neo
BZ61021 1 Vial

PCMV-GSTM4 (human) -3xHA-Neo

Sign In for Pricing
View Details