Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGF-BB

PDGFs are disulfide-linked dimers consisting of two 12.0-13.5 kDa polypeptide chains, designated PDGF-A and PDGF-B chains. The three naturally occurring PDGFs; PDGF-AA, PDGF-BB and PDGF-AB, are potent mitogens for a variety of cell types including smooth muscle cells, connective tissue cells, bone and cartilage cells, and some blood cells. The PDGFs are stored in platelet alpha-granules and are released upon platelet activation. The PDGFs are involved in a number of biological processes, including hyperplasia, chemotaxis, embryonic neuron development, and respiratory tubule epithelial cell development. Two distinct signaling receptors used by PDGFs have been identified and named PDGFR-alpha and PDGFR-beta. PDGFR-alpha is high-affinity receptor for each of the three PDGF forms. On the other hand, PDGFR-beta interacts with only PDGF-BB and PDGF-AB. Recombinant human PDGF-BB is a 24.3 kDa disulfide-linked homodimer of two B chains (218 total amino acids) .

Product Specifications

Synonyms

PDGF-2; Platelet-derived growth factor B chain; Platelet-derived growth factor beta polypeptide; Proto-oncogene c-Sis; INN=Becaplermin

NCBI Gene ID

5155

UniProt

P01127

Accession Number

NP_002599.1

Accession Number mRNA

NM_002608.2

Chromosomal Location

22q13.1

Reactivity

Human

Cross Reactivity

Human

Sequence

SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT

Assay Protocol

Centrifuge vial prior to opening. The lyophilized PDGF-BB should be reconstituted in 50mM acetic acid to a concentration not lower than 100μg/ml. For long term storage of reconstituted protein addition of carrier protein (e.g. BSA or HSA; 0.1%) is recommended.

Endotoxin

< 0.1 ng per ug of PDGF-BB

Purity

> 95% by SDS-PAGE

Bioactivity

The biological activity was determined by the induction of proliferation in NHDF cells (Normal Human Dermal Fibroblasts) .

Length

109

Form

Lyophilized

Buffer

50mM acetic acid

Reconstitution

50mM acetic acid

Molecular Weight

24.3 kDa

Storage Conditions

The lyophilized PDGF-BB is stable for a few weeks at room temperature, but best stored at -20°C. Reconstituted PDGF-BB is best stored at -20°C to -70°C.

Host or Source

E. coli

N Terminal Sequence

SLGSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Thyroglobulin Rabbit Monoclonal Antibody
MA5420-.05 50 µL

Anti-Thyroglobulin Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
PE/Cy5 Anti-human CD38 Antibody *HI157*
103811M2-AAT 500 Tests

PE/Cy5 Anti-human CD38 Antibody *HI157*

Sign In for Pricing
View Details
2'-Deoxyguanosine monohydrate
sc-238433A 100 mg

2'-Deoxyguanosine monohydrate

Sign In for Pricing
View Details
ZNF777 Rabbit Polyclonal Antibody (Cy3)
orb973994 100 µL

ZNF777 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Human CHD2 activation kit by CRISPRa
GA100788 1 Kit

Human CHD2 activation kit by CRISPRa

Sign In for Pricing
View Details
CD44 (CD 44 Antigen, CDw44, CSPG8, Epican, Extracellular Matrix Receptor III, ECMRIII, ECMR-III, GP90 Lymphocyte Homing Adhesion Receptor, HCAM, HCELL, Heparan Sulfate Proteoglycan, Hermes Antigen, HUTCH1, HUTCH-I, Hyaluronate Receptor, Indian Blood Group, Ly-24, LHR, MC56, MDU2, MDU3, MGC10468, MIC4, Phagocytic Glycoprotein 1, PGP1, PGP-1, Phagocytic Glycoprotein I, PGP-I) discontinued. see C2398-07
C2398-06M 1 mL

CD44 (CD 44 Antigen, CDw44, CSPG8, Epican, Extracellular Matrix Receptor III, ECMRIII, ECMR-III, GP90 Lymphocyte Homing Adhesion Receptor, HCAM, HCELL, Heparan Sulfate Proteoglycan, Hermes Antigen, HUTCH1, HUTCH-I, Hyaluronate Receptor, Indian Blood Group, Ly-24, LHR, MC56, MDU2, MDU3, MGC10468, MIC4, Phagocytic Glycoprotein 1, PGP1, PGP-1, Phagocytic Glycoprotein I, PGP-I) discontinued. see C2398-07

Sign In for Pricing
View Details