Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ostreolysin (Cytolysin)

Ostreolysin, is a cytosolic protein of 15 kDa pore-forming protein from the edible oyster mushroom (Pleurotus ostreatus), is lytic to membranes containing both cholesterol and sphingomyelin. Its cytotoxicity to Chinese hamster ovary cells correlates with their cholesterol contents and with the occurrence of ostreolysin in the cells detergent resistant membranes. Moreover, ostreolysin binds to supported monolayers and efficiently permeabilizes sonicated lipid vesicles, only if cholesterol is combined with either sphingomyelin or dipalmitoyl-phosphatidylcholine. Addition of mono- or di-unsaturated phosphatidylcholine to the cholesterol/sphingomyelin vesicles dramatically reduces the ostreolysin's activity. It appears that the protein recognizes specifically a cholesterol-rich lipid phase, probably the liquid-ordered phase. Ostreolysin was purified by combination of ion-exchange and size-exclusion chromatography.

Product Specifications

Synonyms

Ostreolysin A6

UniProt

P83467

Accession Number

AGH25589.1

Accession Number mRNA

KC012711.1

Reactivity

Pleurotus ostreatus

Cross Reactivity

Oyster mushroom

Sequence

AYAQWVIIIIHNVGSQDVKIKNLKASWGKLHADGDKDAEVSASNYEGKIVKPDEKLQINACGRSDAAEGTTGTFDLVDPADGDKQVRHFYWDCPWGSKTNTWTVSGSNTKWMIEYSGQNLDSGALGTITVDTLKKGN

Assay Protocol

It is recommended to reconstitute the lyophilized ostreolysin in sterile 0.4% NaHCO3 adjusted, not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

Endotoxin

< 0.1 ng/µg of protein (< 1EU/µg)

Purity

> 98.0% as determined by Gel filtration and SDS-PAGE gel.

Bioactivity

Ostreolysin has potent anti-carcinogenic activity in several colon cancer cell lines.

Length

137

Form

Lyophilized

Reconstitution

0.4% NaHCO3, pH 8-9

Molecular Weight

14.9 kDa

Host or Source

E. coli

N Terminal Sequence

AYAQWV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibrillin 1 (PE)
F4195-02-PE 100 µL

Fibrillin 1 (PE)

Sign In for Pricing
View Details
Digoxigenin antibody
70R-10656 1 mg

Digoxigenin antibody

Sign In for Pricing
View Details
H PNPLA3 Expression Lentivirus
LVP873 1x 10^7 IFU/mL - 200 μL

H PNPLA3 Expression Lentivirus

Sign In for Pricing
View Details
hnRNP A/B HDR Plasmid (h)
sc-403454-HDR 20 µg

hnRNP A/B HDR Plasmid (h)

Sign In for Pricing
View Details
Mouse Fam216b Pre-designed siRNA Set B
SI104652B 1 Each

Mouse Fam216b Pre-designed siRNA Set B

Sign In for Pricing
View Details
Olfr1270 Lentiviral Activation Particles (m)
sc-435069-LAC 200 µL

Olfr1270 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details