Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mdg-1

Angiogenesis research has focused on receptors and ligands mediating endothelial cell proliferation and migration. Little is known about the molecular mechanisms that are involved in converting endothelial cells from a proliferative to a differentiated state. Microvascular differentiation gene 1 (Mdg1) has been isolated from differentiating microvascular endothelial cells that had been cultured in collagen type I gels (3D culture) . In adult human tissue Mdg1 is expressed in endothelial and epithelial cells. Sequence analysis of the full-length cDNA revealed that the N-terminal region of the putative Mdg1-protein exhibits a high sequence similarity to the J-domain of Hsp40 chaperones. It was shown that this region functions as a bona fide J-domain as it can replace the J-domain of Escherichia coli DnaJ-protein. Mdg1 is also upregulated in primary endothelial and mesangial cells when subjected to various stress stimuli. GFP–Mdg1 fusion constructs showed the Mdg1-protein to be localized within the cytoplasm under control conditions. Stress induces the translocation of Mdg1 into the nucleus, where it accumulates in nucleoli. Costaining with Hdj1, Hdj2, Hsp70, and Hsc70 revealed that Mdg1 colocalizes with Hsp70 and Hdj1 in control and stressed HeLa cells. These data suggest that Mdg1 is involved in the control of cell cycle arrest taking place during terminal cell differentiation and under stress conditions.

Product Specifications

Synonyms

Microvascular endothelial differentiation gene 1 protein, DnaJ homolog subfamily B member 9, ERdj4

NCBI Gene ID

4189

UniProt

Q9UBS3

Accession Number

NP_036460.1

Accession Number mRNA

NM_012328.2

Reactivity

Human

Cross Reactivity

Human

Sequence

MKHHHHHHSAGLEVLFQGPMASKSYYDTLGVPKSASERQIKKAFHKLAMKYHPDKNKSPDAEAKFREIAEAYETLSDANRRKEYDTLGHSAFTSGKGQRGSGSSFEQSFNFNFDDLFKDFGFFGQNQNTGSKKRFENHFQTRQDGGSSRQRHHFQEFSFGGGLFDDMFEDMEKMFSFSGFDSTNQHTVQTENRFHGSSKHCRTVTQRRGNMVTTYTDCSGQ

Purity

> 95% by SDS-PAGE

Length

221

Form

Lyophilized

Molecular Weight

25.3 kDa

Host or Source

E. coli

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Paupar activation kit by CRISPRa
GA219770 1 Kit

Mouse Paupar activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant HMPV N/Nucleoprotein Protein, N-His
YVV30001 100 μg

Recombinant HMPV N/Nucleoprotein Protein, N-His

Sign In for Pricing
View Details
BAD, phosphorylated (S99) (Bcl-2 Antagonist of Cell Death, BBC6, BCL2L8)
145397 100 µg

BAD, phosphorylated (S99) (Bcl-2 Antagonist of Cell Death, BBC6, BCL2L8)

Sign In for Pricing
View Details
Methyl 3- ((3- (dimethylamino) propyl) amino) propanoate
OR1047912-01 100 mg

Methyl 3- ((3- (dimethylamino) propyl) amino) propanoate

Sign In for Pricing
View Details
Methyl 3- ((3- (dimethylamino) propyl) amino) propanoate
OR1047912-02 250 mg

Methyl 3- ((3- (dimethylamino) propyl) amino) propanoate

Sign In for Pricing
View Details
Methyl 3- ((3- (dimethylamino) propyl) amino) propanoate
OR1047912-03 1 g

Methyl 3- ((3- (dimethylamino) propyl) amino) propanoate

Sign In for Pricing
View Details