Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Leptin B Recombinant Protein

Full‐length cDNA encoding two leptin sequences (tLepA and tLepB) were identified in tilapia (Oreochromis niloticus). The cDNAs of tLepA and tLepB were 486 bp and 459 bp in length, encoding proteins of 161 aa and 152 aa, respectively. The tLepB ‐expressing plasmid was transformed into E. coli and expressed as recombinant proteins upon induction with nalidixic acid, found almost entirely in insoluble inclusion bodies (IBs). The protein was solubilized, refolded and purified to homogeneity by anion‐exchange chromatography. More information can be found in Shpilman et al. (2014) General and Comparative Endocrinology 270, 74-85.

Product Specifications

CAS Number

9000-83-3

Synonyms

Lep; ob; obese

NCBI Gene ID

100704338

UniProt

A0A067Z7V9

Accession Number

NP_001287978.1

Accession Number mRNA

NM_001301049.1

Host

E. coli

Origin Species

Tilapia

Species Reactivity

Tilapia

Sequence

ALLTKGESIKNTIHNIVNIAQITLVHIKKLKLPATPTEVPTPSIDGLSSISHDLGVLDNELQHPFLIQIQADVSSLEGRVRSFALSMECPLKPKPAVQTDESVFPDSRLYMTVAKVQHYLEKLILNKGKLKLC

Detection Range

Monomeric and dimeric Tilapia leptins were biologically active in promoting proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor (hLepR), but their activity was four orders of magnitude lower than that of mammalian leptin. Furthermore, the Tilapia leptins were biologically active in promoting STAT‐LUC activation in COS7 cells transfected with Tilapia leptin receptor but not in cells transfected with human leptin receptor. Tilapia Leptin A was more active than Tilapia Leptin B.

Endotoxin

< 0.1 ng/µg of protein (<1EU/µg)

Purity

> 95.0% as determined by Gel filtration and SDS-PAGE gel.

Length

133

Form

Lyophilized

Reconstitution

It is recommended to reconstitute the lyophilized recombinant Tilapia leptin B in sterile water or sterile 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml, which can then be further diluted with other aqueous solutions.

Molecular Weight

14.6 kDa

Shipping Conditions

Room Temperature

N Terminal Sequence

ALLTKG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nucleolar Complex Associated 4 Homolog (NOC4L) Antibody
abx146256-01 100 µg

Nucleolar Complex Associated 4 Homolog (NOC4L) Antibody

Sign In for Pricing
View Details
Nucleolar Complex Associated 4 Homolog (NOC4L) Antibody
abx146256-02 1 mg

Nucleolar Complex Associated 4 Homolog (NOC4L) Antibody

Sign In for Pricing
View Details
HFE2 (Hemojuvelin, Hemochromatosis Type 2 Protein, RGM Domain Family Member C, JH, HJV, RGMC, HFE2A) (MaxLight 650)
MBS6420300-01 0.1 mL

HFE2 (Hemojuvelin, Hemochromatosis Type 2 Protein, RGM Domain Family Member C, JH, HJV, RGMC, HFE2A) (MaxLight 650)

Sign In for Pricing
View Details
HFE2 (Hemojuvelin, Hemochromatosis Type 2 Protein, RGM Domain Family Member C, JH, HJV, RGMC, HFE2A) (MaxLight 650)
MBS6420300-02 5x 0.1 mL

HFE2 (Hemojuvelin, Hemochromatosis Type 2 Protein, RGM Domain Family Member C, JH, HJV, RGMC, HFE2A) (MaxLight 650)

Sign In for Pricing
View Details
CNR1 (Cannabinoid Receptor 1 (Brain), CANN6, CB-R, CB1, CB1A, CB1K5, CB1R, CNR) (MaxLight 490)
244811-ML490 100 µL

CNR1 (Cannabinoid Receptor 1 (Brain), CANN6, CB-R, CB1, CB1A, CB1K5, CB1R, CNR) (MaxLight 490)

Sign In for Pricing
View Details
LRRTM2 Protein Vector (Human) (pPB-C-His)
PV054861 500 ng

LRRTM2 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details