Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-22 receptor antagonist (Y51A)

IL-22 is a member of the IL-10 family of regulatory cytokines which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences, but they are dissimilar in their biological functions. Produced by T lymphocytes, IL-22 inhibits IL-4 production by Th2 cells, and induces acute phase reactants in the liver and pancreas. IL-22 signals through a receptor system consisting of IL-10R-beta/CRF2-4 and IL-22R, both of which are members of the class II cytokine-receptor family. Recombinant murine IL-22 mutant Y51A (numbering according to human IL-22 including signal peptide) produced in E.Coli is a single, non-glycosylated polypeptide chain containing 147 amino acids and having a molecular mass of 16.7 kDa. Preparation of recombinant mIL-22 antagonists provides new tools for the study of IL-22 activity and of eventual therapeutic means for attenuating its negative effects. For more details see L. Niv-Spector et al. Protein Eng Des Sel. (PEDS) 25:397-404 (2012) .

Product Specifications

Synonyms

IL22; IL-22; Iltif; IL-22a; ILTIFa

NCBI Gene ID

50929

UniProt

Q9JJY9

Accession Number

NP_058667.1

Accession Number mRNA

NM_016971

Reactivity

Mouse

Cross Reactivity

Mouse

Sequence

ALPVNTRCKLEVSNFQQPAIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV

Assay Protocol

It is recommended to reconstitute the lyophilized IL-22 Y51A in sterile H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions containing carrier protein such as BSA, HSA or similar.

Endotoxin

< 0.1 ng/µg of protein (< 1EU/µg)

Purity

> 98.0% as determined by Gel filtration and SDS-PAGE gel.

Bioactivity

Recombinant murine IL-22 Y51A mutant is capable of full inhibition of STAT3 phosphorylation induced by mouse interleukin 22 in HepG cells. Its affinity toward immobilized mIL-22 receptor α1 extracellular domain (mIL-22 Rα1-ECD) or IL-22 binding protein is similar to the non mutated mouse interleukin 22. Mouse IL-22 antagonist (Y51A) has no agonistic activity in this bioassay.

Length

147

Form

Lyophilized

Reconstitution

Water

Molecular Weight

16.7 kDa

Host or Source

E. coli

N Terminal Sequence

ALPVN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human sex hormone-binding globulin, SHBG ELISA Kit
MBS702745-01 24 Well (LIMIT 1)

Human sex hormone-binding globulin, SHBG ELISA Kit

Sign In for Pricing
View Details
Human sex hormone-binding globulin, SHBG ELISA Kit
MBS702745-02 48 Well

Human sex hormone-binding globulin, SHBG ELISA Kit

Sign In for Pricing
View Details
Human sex hormone-binding globulin, SHBG ELISA Kit
MBS702745-03 96 Well

Human sex hormone-binding globulin, SHBG ELISA Kit

Sign In for Pricing
View Details
Human sex hormone-binding globulin, SHBG ELISA Kit
MBS702745-04 5x 96 Well

Human sex hormone-binding globulin, SHBG ELISA Kit

Sign In for Pricing
View Details
Human sex hormone-binding globulin, SHBG ELISA Kit
MBS702745-05 10x 96 Well

Human sex hormone-binding globulin, SHBG ELISA Kit

Sign In for Pricing
View Details
Recombinant Tryptophan Hydroxylase 2 (TPH2)
SIPG514Mu02-01 10 µg

Recombinant Tryptophan Hydroxylase 2 (TPH2)

Sign In for Pricing
View Details