Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-2 (basic)

The FGF family is composed of at least 23 polypeptides that show a variety of biological activities towards cells of mesenchymal, neuronal and epithelial origin. All members are heparin-binding growth factors (HB-GF) . Until the structure of basic fibroblast growth factor (bFGF/FGF-2) was determined, a number of synonyms was used to describe this growth factor. As is often the case, the nomenclature reflected the observed activities reported by individual groups. Basic FGF has been reported as leukemia growth factor, macrophage growth factor, endothelial growth factor and tumor angiogenesis factor. The eventual isolation and characterization of bFGF was done from soluble brain extracts. bFGF was found to have a molecular mass of 16.5 kDa and to be 154 amino acids in length. Interestingly, bFGF contains no hydrophobic leader sequence previously thought to be required for cell secretion. Basic FGF bears 55% homology to acidic FGF and also seems to exist in three forms: the 154 amino-acid form and two other truncated versions of 146 and 131 amino acids lacking the N-terminal 9 and 24 residues. Acidic and basic FGF compete for the binding to 125 kDa and 145 kDa receptor species. However, acidic FGF has a higher affinity for the 125 kDa species, while basic FGF has a higher affinity for the 145 kDa species. FGF receptor activation leads to the activation of MAP kinase and protein kinase C. FGF’s induce the proliferative response in cells derived from mesoderm and neuroectoderm. It seems that basic FGF reduces the average doubling time by shortening the G1 phase of the cell cycle. Furthermore, it has been reported to induce the release of plasminogen activator by endothelial cells. Perhaps one of the most potentially significant applications of bFGF is related to its reported ability to induce angiogenesis.

Product Specifications

Synonyms

Fgf2; Fgfb; bFGF; Fgf-2

NCBI Gene ID

14173

UniProt

P15655

Accession Number

NP_032032.1

Accession Number mRNA

NM_008006.2

Chromosomal Location

3 A2-B; 3 19.3 cM

Reactivity

Mouse

Cross Reactivity

Mouse

Sequence

ALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Assay Protocol

The lyophilized basic FGF should be reconstituted in water containing at least 0.1% human or bovine serum albumin to a concentration not lower than 10µg/ml.

Endotoxin

< 0.1 ng per µg of mouse FGF-2

Purity

> 98% by SDS-PAGE

Bioactivity

The ED50 for stimulation of cell proliferation by human umbilical vein endothelial cells for mouse FGF-2 has been determined to be in the range of 0.1-2 ng/ml.

Length

144

Form

Lyophilized

Buffer

PBS

Reconstitution

Water

Molecular Weight

16.35 kDa

Storage Conditions

Lyophilized samples are stable for greater than six months at -20°C to -70°C. Basic FGF can be stored in high-salt buffer (PBS, 1M NaCl) at 4°C for 2-4 weeks.

Host or Source

E. coli

N Terminal Sequence

ALPEDDGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human FAAH shRNA (UAS) - Lentiviral human FAAH shRNA (UAS) plasmid
GTR15318802 1 Vial

Lentiviral human FAAH shRNA (UAS) - Lentiviral human FAAH shRNA (UAS) plasmid

Sign In for Pricing
View Details
Ubl7 Mouse qPCR Template Standard (NM_027086)
MK205083 1 Kit

Ubl7 Mouse qPCR Template Standard (NM_027086)

Sign In for Pricing
View Details
SAMSN1 Polyclonal Antibody, HRP Conjugated
A60777-050 50 µL

SAMSN1 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
6,6-Diethyl-4,5,6,7-tetrahydro-1,3-benzothiazol-2-amine hydrobromide
JBD30505-01 50 mg

6,6-Diethyl-4,5,6,7-tetrahydro-1,3-benzothiazol-2-amine hydrobromide

Sign In for Pricing
View Details
6,6-Diethyl-4,5,6,7-tetrahydro-1,3-benzothiazol-2-amine hydrobromide
JBD30505-02 0.5 g

6,6-Diethyl-4,5,6,7-tetrahydro-1,3-benzothiazol-2-amine hydrobromide

Sign In for Pricing
View Details
ALDH9A1 ORF Vector (Human) (pORF)
11746011 1.0 µg DNA

ALDH9A1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details