Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-2 (basic)

FGF basic (FGF2, HBGF2) is one of at least 23 mitogenic proteins of the FGF family, which show 35-60% amino acid conservation. Unlike other FGFs, FGF acidic and basic lack signal peptides and are secreted by an alternate pathway. Storage pools within the cell or on cell surface heparan sulfate proteoglycans (HSPG) are likely. The predicted 17 kDa FGF basic isoform can be located in both the cytoplasm and the nucleus and is presumed to be the form secreted. Transcription from alternate start sites produces 21-24 kDa forms found only in the nucleus. High and low molecular weight human FGF basic targets the expression of different genes when expressed in NIH3T3 cells. The 17 kDa mouse sequence has 98% aa identity with rat, and 95% identity with human, bovine and sheep FGF basic. Autocrine, intracrine and paracrine actions of FGF basic have been identified. Binding of FGF to heparin or cell surface HSPG is necessary for binding, dimerization and activation of tyrosine kinase FGF receptors. FGF basic binds other proteins, polysaccharides and lipids with lower affinity. Expression of FGF basic is nearly ubiquitous but disruption of the mouse FGF basic gene gives a relatively mild phenotype, suggesting compensation by other FGF family members. FGF basic modulates such normal processes as angiogenesis, wound healing and tissue repair, embryonic development and differentiation, neuronal function and neural degeneration. Transgenic overexpression of FGF basic results in excessive proliferation and angiogenesis reminiscent of a variety of pathological conditions.

Product Specifications

Synonyms

FGF2; BFGF; FGFB; HBGF-2; basic Fibroblast growth factor (bFGF) ; Heparin binding growth factor-2

NCBI Gene ID

2247

UniProt

P09038

Accession Number

NP_001997.5

Accession Number mRNA

NM_002006.4

Chromosomal Location

4q26

Reactivity

Human

Cross Reactivity

Human, Mouse

Sequence

AGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Assay Protocol

The lyophilized FGF-2 (basic) should be reconstituted in water to a concentration not lower than 50 µg/ml. For long term storage we would recommend to add at least 0.1% human or bovine serum albumin.

Endotoxin

< 0.1 ng per µg of human FGF-2

Purity

> 98% by SDS-PAGE

Bioactivity

The ED50 for stimulation of cell proliferation in HUVECs by human FGF-2 (basic) has been determined to be in the range of 0.1-2 ng/ml. The WHO standard #90/712 was used as control.

Length

153

Form

Lyophilized

Buffer

PBS

Reconstitution

Water

Molecular Weight

17.0 kDa

Storage Conditions

Lyophilized samples are stable for greater than six months at -20°C to -70°C.

Host or Source

E. coli

N Terminal Sequence

AGSITTL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Ana o 3 Human IgE Antibody (2F5)
MBS1586960-01 0.1 mg

Anti-Ana o 3 Human IgE Antibody (2F5)

Sign In for Pricing
View Details
Anti-Ana o 3 Human IgE Antibody (2F5)
MBS1586960-02 1 mg

Anti-Ana o 3 Human IgE Antibody (2F5)

Sign In for Pricing
View Details
Anti-Ana o 3 Human IgE Antibody (2F5)
MBS1586960-03 5x 1 mg

Anti-Ana o 3 Human IgE Antibody (2F5)

Sign In for Pricing
View Details
Rhox10 Protein Vector (Mouse) (pPM-C-HA)
39533024 500 ng

Rhox10 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
G6PC Antibody; Biotin conjugated
MBS7002850-01 0.05 mg

G6PC Antibody; Biotin conjugated

Sign In for Pricing
View Details
G6PC Antibody; Biotin conjugated
MBS7002850-02 0.1 mg

G6PC Antibody; Biotin conjugated

Sign In for Pricing
View Details