Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD133/PROM1, Rat (HEK293, Fc)

The CD133/PROM1 protein is critical for multiple processes including glomerular epithelial cell differentiation and retinal morphogenesis, showing biased expression in tissues such as lung and kidney. CD133/PROM1 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD133/PROM1 protein, expressed by HEK293 , with N-mFc labeled tag.

Product Specifications

Product Name Alternative

CD133/PROM1 Protein, Rat (HEK293, Fc), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd133-prom1-protein-rat-hek293-fc.html

Purity

90.00

Smiles

NQQTRTRIQRTQKLAESNYRDLRALLTEAPKQIDYILGQYNTTKNKAFSDLDSIDSVLGGRIKGQLKPKVTPVLEEIKAMATAIRQTKDALQNMSSSLKSLRDASTQLSTNLTSVRNSIENSLNSNDCASDPASKICDSLRPQLSNLGSNHNGSQLQSVDRELNTVNDVDRTDLESLVKRGYMSIDEIPNMIQNQTGDVIKDVKKTLDSVSSKVKNMSQSIPVEEVLLQFSHYLNDSNRYIHESLPRVEEYDSY

Molecular Formula

60357 (Gene_ID) NP_001103607.1 (N171-Y424) (Accession)

Molecular Weight

Approximately 70-95 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TKT Antibody
OAAN01725-200UL 200 µL

TKT Antibody

Sign In for Pricing
View Details
ARHGEF4 Antibody
orb1562274-01 50 µL

ARHGEF4 Antibody

Sign In for Pricing
View Details
ARHGEF4 Antibody
orb1562274-02 100 µL

ARHGEF4 Antibody

Sign In for Pricing
View Details
ARHGEF4 Antibody
orb1562274-03 200 µL

ARHGEF4 Antibody

Sign In for Pricing
View Details
CD55 Protein Vector (Mouse) (pPM-C-HA)
15553024 500 ng

CD55 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Human Ephrin type-A receptor 2 (EPHA2), partial
MBS959316-01 0.02 mg (E-Coli)

Recombinant Human Ephrin type-A receptor 2 (EPHA2), partial

Sign In for Pricing
View Details