Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Osteocalcin (BGLAP)

Product Specifications

Product Name Alternative

Bone Gla protein (BGP) (Gamma-carboxyglutamic acid-containing protein)

Abbreviation

Recombinant Dog BGLAP protein

Gene Name

BGLAP

UniProt

P81455

Expression Region

1-49aa

Organism

Canis lupus familiaris (Dog) (Canis familiaris)

Target Sequence

YLDSGLGAPVPYPDPLEPKREVCELNPNCDELADHIGFQEAYQRFYGPV

Tag

N-terminal 6xHis-KSI-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

20.9 kDa

References & Citations

"Isolation and complete amino acid sequence of osteocalcin from canine bone." Colombo G., Fanti P., Yao C., Malluche H.H. J. Bone Miner. Res. 8:733-743 (1993)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal ACBD7 Antibody (005) [mFluor Violet 500 SE]
NBP2-90286MFV500 0.1 mL

Rabbit Monoclonal ACBD7 Antibody (005) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
[KO Validated] MLH1 Rabbit mAb
A4858 20 µL

[KO Validated] MLH1 Rabbit mAb

Sign In for Pricing
View Details
BACH2 shRNA (m) Lentiviral Particles
sc-37707-V 200 µL

BACH2 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Slc13a1 (NM_031651) Rat Tagged ORF Clone Lentiviral Particle
RR210719L3V 200 µL

Slc13a1 (NM_031651) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
MRPS21P6 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV771132 1.0 µg DNA

MRPS21P6 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Islr2 (NM_001161538) Mouse Tagged Lenti ORF Clone
MR224405L3 10 µg

Islr2 (NM_001161538) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details