Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SDC4, Mouse (HEK293, Fc)

SDC4 protein is a cell surface proteoglycan that cooperates with SDCBP and PDCD6IP to regulate exosome biogenesis.SDC4 exists as a homodimer and engages in important interactions with various intracellular partners.SDC4 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived SDC4 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

SDC4 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sdc4-protein-mouse-hek293-fc.html

Purity

97.30

Smiles

ESIRETEVIDPQDLLEGRYFSGALPDDEDAGGSDDFELSGSGDLDDTEEPRPFPEVIEPLVPLDNHIPENAQPGIRVPSEPKELEENEVIPKRAPSDVGDDMSNKVSMSSTAQGSNIFERTEV

Molecular Formula

20971 (Gene_ID) O35988 (E24-V146) (Accession)

Molecular Weight

Approximately 50-55 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Common gamma Chain/IL-2 R gamma Antibody (MM0195-7A23)
NBP2-12201-0.025mg 0.025 mg

Mouse Monoclonal Common gamma Chain/IL-2 R gamma Antibody (MM0195-7A23)

Sign In for Pricing
View Details
GENLISA Hantavirus Antibody ELISA
KBVH063 1x 96 Well

GENLISA Hantavirus Antibody ELISA

Sign In for Pricing
View Details
PerCP Anti-human CD279 Antibody *J110*
127921T1-AAT 100 Tests

PerCP Anti-human CD279 Antibody *J110*

Sign In for Pricing
View Details
STON1 Antibody
MBS856045-01 0.1 mg

STON1 Antibody

Sign In for Pricing
View Details
STON1 Antibody
MBS856045-02 0.1 mL (AF635)

STON1 Antibody

Sign In for Pricing
View Details
STON1 Antibody
MBS856045-03 0.1 mL (AF610)

STON1 Antibody

Sign In for Pricing
View Details