Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COMMD9, Human (His)

COMMD9 protein regulates the cullin-RING E3 ubiquitin ligase (CRL) complex and regulates ubiquitin-dependent protein degradation. It downregulates NF-kappa-B activation and affects immune and inflammatory responses. COMMD9 Protein, Human (His) is the recombinant human-derived COMMD9 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

COMMD9 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/commd9-protein-human-his.html

Purity

93.40

Smiles

MAALTAEHFAALQSLLKASSKDVVRQLCQESFSSSALGLKKLLDVTCSSLSVTQEEAEELLQALHRLTRLVAFRDLSSAEAILALFPENFHQNLKNLLTKIILEHVSTWRTEAQANQISLPRLVDLDWRVDIKTSSDSISRMAVPTCLLQMKIQEDPSLCGDKPSISAVTVELSKETLDTMLDGLGRIRDQLSAVASK

Molecular Formula

29099 (Gene_ID) Q9P000-1 (M1-K198) (Accession)

Molecular Weight

Approximately 24 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-LCE6A antibody
SL18186R-01 50 µL

Rabbit Anti-LCE6A antibody

Sign In for Pricing
View Details
Rabbit Anti-LCE6A antibody
SL18186R-02 100 µL

Rabbit Anti-LCE6A antibody

Sign In for Pricing
View Details
CD93/C1qR1 Protein, Human, Recombinant (His)
TMPY-02268-01 5 µg

CD93/C1qR1 Protein, Human, Recombinant (His)

Sign In for Pricing
View Details
CD93/C1qR1 Protein, Human, Recombinant (His)
TMPY-02268-02 10 µg

CD93/C1qR1 Protein, Human, Recombinant (His)

Sign In for Pricing
View Details
CD93/C1qR1 Protein, Human, Recombinant (His)
TMPY-02268-03 20 µg

CD93/C1qR1 Protein, Human, Recombinant (His)

Sign In for Pricing
View Details
CD93/C1qR1 Protein, Human, Recombinant (His)
TMPY-02268-04 50 µg

CD93/C1qR1 Protein, Human, Recombinant (His)

Sign In for Pricing
View Details