Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COMMD9, Human (His)

COMMD9 protein regulates the cullin-RING E3 ubiquitin ligase (CRL) complex and regulates ubiquitin-dependent protein degradation. It downregulates NF-kappa-B activation and affects immune and inflammatory responses. COMMD9 Protein, Human (His) is the recombinant human-derived COMMD9 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

COMMD9 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/commd9-protein-human-his.html

Purity

93.40

Smiles

MAALTAEHFAALQSLLKASSKDVVRQLCQESFSSSALGLKKLLDVTCSSLSVTQEEAEELLQALHRLTRLVAFRDLSSAEAILALFPENFHQNLKNLLTKIILEHVSTWRTEAQANQISLPRLVDLDWRVDIKTSSDSISRMAVPTCLLQMKIQEDPSLCGDKPSISAVTVELSKETLDTMLDGLGRIRDQLSAVASK

Molecular Formula

29099 (Gene_ID) Q9P000-1 (M1-K198) (Accession)

Molecular Weight

Approximately 24 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Baculovirus Penaei Real Time PCR Detection kit
BSN12S1 16 Tests

Baculovirus Penaei Real Time PCR Detection kit

Sign In for Pricing
View Details
Protein kinase Y linked (PRKY) Mouse Monoclonal Antibody [Clone 3D11]
E45M09228V-2 50 µL

Protein kinase Y linked (PRKY) Mouse Monoclonal Antibody [Clone 3D11]

Sign In for Pricing
View Details
PTMA 3'UTR Lenti-reporter-Luc Vector
38114081 1.0 µg

PTMA 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Neurofilament (NEFL) Mouse Monoclonal Antibody [Clone ID: OTI5A1]
TA814326 100 µL

Neurofilament (NEFL) Mouse Monoclonal Antibody [Clone ID: OTI5A1]

Sign In for Pricing
View Details
Goat L1-Cell Adhesion Molecule ELISA Kit
MBS018698 Inquire

Goat L1-Cell Adhesion Molecule ELISA Kit

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae Glycerol-3-phosphate acyltransferase (plsY), partial
MBS7066906 Inquire

Recombinant Streptococcus pneumoniae Glycerol-3-phosphate acyltransferase (plsY), partial

Sign In for Pricing
View Details