Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COMMD9, Human (His)

COMMD9 protein regulates the cullin-RING E3 ubiquitin ligase (CRL) complex and regulates ubiquitin-dependent protein degradation. It downregulates NF-kappa-B activation and affects immune and inflammatory responses. COMMD9 Protein, Human (His) is the recombinant human-derived COMMD9 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

COMMD9 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/commd9-protein-human-his.html

Purity

93.40

Smiles

MAALTAEHFAALQSLLKASSKDVVRQLCQESFSSSALGLKKLLDVTCSSLSVTQEEAEELLQALHRLTRLVAFRDLSSAEAILALFPENFHQNLKNLLTKIILEHVSTWRTEAQANQISLPRLVDLDWRVDIKTSSDSISRMAVPTCLLQMKIQEDPSLCGDKPSISAVTVELSKETLDTMLDGLGRIRDQLSAVASK

Molecular Formula

29099 (Gene_ID) Q9P000-1 (M1-K198) (Accession)

Molecular Weight

Approximately 24 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VUF 8430 dihydrobromide
B7077-25 25 mg

VUF 8430 dihydrobromide

Sign In for Pricing
View Details
Human SAFB qPCR Primer Pair
QH22197S 200 Tests

Human SAFB qPCR Primer Pair

Sign In for Pricing
View Details
Human beta Subunits of hemoglobin ELISA Kit
MBS726480-01 48 Strip Well (Competitive)

Human beta Subunits of hemoglobin ELISA Kit

Sign In for Pricing
View Details
Human beta Subunits of hemoglobin ELISA Kit
MBS726480-02 48 Strip Well (Sandwich)

Human beta Subunits of hemoglobin ELISA Kit

Sign In for Pricing
View Details
Human beta Subunits of hemoglobin ELISA Kit
MBS726480-03 96 Strip Well (Competitive)

Human beta Subunits of hemoglobin ELISA Kit

Sign In for Pricing
View Details
Human beta Subunits of hemoglobin ELISA Kit
MBS726480-04 96 Strip Well (Sandwich)

Human beta Subunits of hemoglobin ELISA Kit

Sign In for Pricing
View Details