Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

14-3-3 theta, Human (His)

14-3-3 theta proteins are adapters in multiple signaling pathways that recognize phosphoserine or phosphothreonine motifs and modulate chaperone activity upon binding. It negatively regulates PDPK1 kinase activity, forms homodimers, and interacts with CDK16, phosphorylated RGS7, SSH1, phosphorylated CDKN1B, GAB2, phosphorylated PDPK1, and phosphorylated DAPK2. 14-3-3 theta Protein, Human (His) is the recombinant human-derived 14-3-3 theta protein, expressed by E. coli , with N-6His labeled tag.

Product Specifications

Product Name Alternative

14-3-3 theta Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/14-3-3-theta-protein-human-his.html

Purity

98.0

Smiles

MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN

Molecular Formula

10971 (Gene_ID) P27348 (M1-N245) (Accession)

Molecular Weight

Approximately 29 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MKRN2 antibody
70R-2131 50 ug

MKRN2 antibody

Sign In for Pricing
View Details
Lanicemine
453535-01 5 mg

Lanicemine

Sign In for Pricing
View Details
Lanicemine
453535-02 10 mg

Lanicemine

Sign In for Pricing
View Details
NFX1 (Transcriptional Repressor NF-X1, Nuclear Transcription Factor, X Box-binding Protein 1, NFX2, DKFZp779G2416, MGC20369) (MaxLight 650)
130346-ML650 100 µL

NFX1 (Transcriptional Repressor NF-X1, Nuclear Transcription Factor, X Box-binding Protein 1, NFX2, DKFZp779G2416, MGC20369) (MaxLight 650)

Sign In for Pricing
View Details
9830147E19Rik sgRNA CRISPR Lentivector set (Mouse)
K4662301 3x 1.0 µg

9830147E19Rik sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
ArylsuLfatase D (ARSD) (NM_001669) Human Recombinant Protein
TP305857 20 µg

ArylsuLfatase D (ARSD) (NM_001669) Human Recombinant Protein

Sign In for Pricing
View Details