Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

14-3-3 theta, Human (His)

14-3-3 theta proteins are adapters in multiple signaling pathways that recognize phosphoserine or phosphothreonine motifs and modulate chaperone activity upon binding. It negatively regulates PDPK1 kinase activity, forms homodimers, and interacts with CDK16, phosphorylated RGS7, SSH1, phosphorylated CDKN1B, GAB2, phosphorylated PDPK1, and phosphorylated DAPK2. 14-3-3 theta Protein, Human (His) is the recombinant human-derived 14-3-3 theta protein, expressed by E. coli , with N-6His labeled tag.

Product Specifications

Product Name Alternative

14-3-3 theta Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/14-3-3-theta-protein-human-his.html

Purity

98.0

Smiles

MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN

Molecular Formula

10971 (Gene_ID) P27348 (M1-N245) (Accession)

Molecular Weight

Approximately 29 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LY2955303 50mg
A19816-50 50 mg

LY2955303 50mg

Sign In for Pricing
View Details
Canine Transforming Growth Factor Beta 2 (TGFb2) ELISA Kit
RD-TGFb2-c-48Tests 48 Tests

Canine Transforming Growth Factor Beta 2 (TGFb2) ELISA Kit

Sign In for Pricing
View Details
NUDT2 (Nudix-type Motif 2, APAH1, Bis (5'-nucleosyl) -tetraphosphatase [Asymmetrical], Diadenosine 5',5'''-P1, P4-tetraphosphate Asymmetrical Hydrolase, Diadenosine Tetraphosphatase, Ap4A Hydrolase, Ap4Aase, Nucleoside Diphosphate-linked Moiety X Motif 2) (M
MBS6387774-01 0.1 mL

NUDT2 (Nudix-type Motif 2, APAH1, Bis (5'-nucleosyl) -tetraphosphatase [Asymmetrical], Diadenosine 5',5'''-P1, P4-tetraphosphate Asymmetrical Hydrolase, Diadenosine Tetraphosphatase, Ap4A Hydrolase, Ap4Aase, Nucleoside Diphosphate-linked Moiety X Motif 2) (M

Sign In for Pricing
View Details
NUDT2 (Nudix-type Motif 2, APAH1, Bis (5'-nucleosyl) -tetraphosphatase [Asymmetrical], Diadenosine 5',5'''-P1, P4-tetraphosphate Asymmetrical Hydrolase, Diadenosine Tetraphosphatase, Ap4A Hydrolase, Ap4Aase, Nucleoside Diphosphate-linked Moiety X Motif 2) (M
MBS6387774-02 5x 0.1 mL

NUDT2 (Nudix-type Motif 2, APAH1, Bis (5'-nucleosyl) -tetraphosphatase [Asymmetrical], Diadenosine 5',5'''-P1, P4-tetraphosphate Asymmetrical Hydrolase, Diadenosine Tetraphosphatase, Ap4A Hydrolase, Ap4Aase, Nucleoside Diphosphate-linked Moiety X Motif 2) (M

Sign In for Pricing
View Details
Recombinant Human NAT9, GST-tagged
NAT9-1197H 25 µg

Recombinant Human NAT9, GST-tagged

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster Uncharacterized protein CG1161 (CG1161), partial
MBS7102336 Inquire

Recombinant Drosophila melanogaster Uncharacterized protein CG1161 (CG1161), partial

Sign In for Pricing
View Details