Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

14-3-3 theta, Human (His)

14-3-3 theta proteins are adapters in multiple signaling pathways that recognize phosphoserine or phosphothreonine motifs and modulate chaperone activity upon binding. It negatively regulates PDPK1 kinase activity, forms homodimers, and interacts with CDK16, phosphorylated RGS7, SSH1, phosphorylated CDKN1B, GAB2, phosphorylated PDPK1, and phosphorylated DAPK2. 14-3-3 theta Protein, Human (His) is the recombinant human-derived 14-3-3 theta protein, expressed by E. coli , with N-6His labeled tag.

Product Specifications

Product Name Alternative

14-3-3 theta Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/14-3-3-theta-protein-human-his.html

Purity

98.0

Smiles

MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN

Molecular Formula

10971 (Gene_ID) P27348 (M1-N245) (Accession)

Molecular Weight

Approximately 29 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat C4 Binding Protein (C4BP) ELISA Kit
YP-W37755-01 48 Tests

Rat C4 Binding Protein (C4BP) ELISA Kit

Sign In for Pricing
View Details
Rat C4 Binding Protein (C4BP) ELISA Kit
YP-W37755-02 96 Tests

Rat C4 Binding Protein (C4BP) ELISA Kit

Sign In for Pricing
View Details
HCN3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0938308 1.0 µg DNA

HCN3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
IGF2 Knockout UMUC-3 Polyclonal Cells
ARG36934 1 Million

IGF2 Knockout UMUC-3 Polyclonal Cells

Sign In for Pricing
View Details
NR1H2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1451406 1.0 µg DNA

NR1H2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
BNIP3 Antibody
A54892-50UL 50 μL

BNIP3 Antibody

Sign In for Pricing
View Details