Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

14-3-3 theta, Human (His)

14-3-3 theta proteins are adapters in multiple signaling pathways that recognize phosphoserine or phosphothreonine motifs and modulate chaperone activity upon binding. It negatively regulates PDPK1 kinase activity, forms homodimers, and interacts with CDK16, phosphorylated RGS7, SSH1, phosphorylated CDKN1B, GAB2, phosphorylated PDPK1, and phosphorylated DAPK2. 14-3-3 theta Protein, Human (His) is the recombinant human-derived 14-3-3 theta protein, expressed by E. coli , with N-6His labeled tag.

Product Specifications

Product Name Alternative

14-3-3 theta Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/14-3-3-theta-protein-human-his.html

Purity

98.0

Smiles

MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN

Molecular Formula

10971 (Gene_ID) P27348 (M1-N245) (Accession)

Molecular Weight

Approximately 29 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal DC-STAMP/TM7SF4 Antibody (788524) [CoraFluor 1]
FAB7824CL1 0.1 mL

Mouse Monoclonal DC-STAMP/TM7SF4 Antibody (788524) [CoraFluor 1]

Sign In for Pricing
View Details
TSPAN3 3'UTR GFP Stable Cell Line
TU077312 1.0 mL

TSPAN3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
SNORD116-11 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2246806 1.0 µg DNA

SNORD116-11 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
KLK1 (m.KLK1, Klk-6, Klk6, mGK-6, Glandular kallikrein K1, KAL-B, KLKR, Renal kallikrein, Tissue kallikrein-6) (MaxLight 490) discontinued
144853-ML490 100 µL

KLK1 (m.KLK1, Klk-6, Klk6, mGK-6, Glandular kallikrein K1, KAL-B, KLKR, Renal kallikrein, Tissue kallikrein-6) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Gm5936 Protein Vector (Mouse) (pPB-N-His)
PV184555 500 ng

Gm5936 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Recombinant Helicobacter pylori Elongation factor Tu (tuf)
MBS1259105-01 0.02 mg (E-Coli)

Recombinant Helicobacter pylori Elongation factor Tu (tuf)

Sign In for Pricing
View Details