Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

14-3-3 theta, Human (His)

14-3-3 theta proteins are adapters in multiple signaling pathways that recognize phosphoserine or phosphothreonine motifs and modulate chaperone activity upon binding. It negatively regulates PDPK1 kinase activity, forms homodimers, and interacts with CDK16, phosphorylated RGS7, SSH1, phosphorylated CDKN1B, GAB2, phosphorylated PDPK1, and phosphorylated DAPK2. 14-3-3 theta Protein, Human (His) is the recombinant human-derived 14-3-3 theta protein, expressed by E. coli , with N-6His labeled tag.

Product Specifications

Product Name Alternative

14-3-3 theta Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/14-3-3-theta-protein-human-his.html

Purity

98.0

Smiles

MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN

Molecular Formula

10971 (Gene_ID) P27348 (M1-N245) (Accession)

Molecular Weight

Approximately 29 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bdkrb2 Rat shRNA Lentiviral Particle (Locus ID 25245)
TL713333V 500 µL Each

Bdkrb2 Rat shRNA Lentiviral Particle (Locus ID 25245)

Sign In for Pricing
View Details
Anti-ACTN2 antibody
PAab00121 100 µg

Anti-ACTN2 antibody

Sign In for Pricing
View Details
ARL4D Protein (N-His, Human)
P500656 100 µg

ARL4D Protein (N-His, Human)

Sign In for Pricing
View Details
CD11b (ITGAM) Rat Monoclonal Antibody [Clone ID: M1/70]
AM50206PU-S 100 µg

CD11b (ITGAM) Rat Monoclonal Antibody [Clone ID: M1/70]

Sign In for Pricing
View Details
ESAM (Endothelial Cell Adhesion Molecule, W117m) (HRP)
245833-HRP 100 µL

ESAM (Endothelial Cell Adhesion Molecule, W117m) (HRP)

Sign In for Pricing
View Details
Recombinant Human NTNG1 Protein - (Dry Ice)
H00022854-P01-25ug 25 µg

Recombinant Human NTNG1 Protein - (Dry Ice)

Sign In for Pricing
View Details