Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

14-3-3 theta, Human (His)

14-3-3 theta proteins are adapters in multiple signaling pathways that recognize phosphoserine or phosphothreonine motifs and modulate chaperone activity upon binding. It negatively regulates PDPK1 kinase activity, forms homodimers, and interacts with CDK16, phosphorylated RGS7, SSH1, phosphorylated CDKN1B, GAB2, phosphorylated PDPK1, and phosphorylated DAPK2. 14-3-3 theta Protein, Human (His) is the recombinant human-derived 14-3-3 theta protein, expressed by E. coli , with N-6His labeled tag.

Product Specifications

Product Name Alternative

14-3-3 theta Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/14-3-3-theta-protein-human-his.html

Purity

98.0

Smiles

MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN

Molecular Formula

10971 (Gene_ID) P27348 (M1-N245) (Accession)

Molecular Weight

Approximately 29 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

UNC5C (Protein Unc-5 Homolog C, Netrin Receptor UNC5C, Protein Unc-5 Homolog 3, UNC5H3) (APC)
135107-APC 100 µL

UNC5C (Protein Unc-5 Homolog C, Netrin Receptor UNC5C, Protein Unc-5 Homolog 3, UNC5H3) (APC)

Sign In for Pricing
View Details
Tfb1m Mouse Pre-designed siRNA Set A
HY-RS21785 1 Set

Tfb1m Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
Olr462 3'UTR GFP Stable Cell Line
TU265227 1.0 mL

Olr462 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Mouse Mylk2 (NM_001081044) AAV Particle
MR219355A1V 250 µL

Mouse Mylk2 (NM_001081044) AAV Particle

Sign In for Pricing
View Details
Zfp148 Peptide - N-terminal region
MBS3229646-01 0.1 mg

Zfp148 Peptide - N-terminal region

Sign In for Pricing
View Details
Zfp148 Peptide - N-terminal region
MBS3229646-02 5x 0.1 mg

Zfp148 Peptide - N-terminal region

Sign In for Pricing
View Details