Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

14-3-3 theta, Human (His)

14-3-3 theta proteins are adapters in multiple signaling pathways that recognize phosphoserine or phosphothreonine motifs and modulate chaperone activity upon binding. It negatively regulates PDPK1 kinase activity, forms homodimers, and interacts with CDK16, phosphorylated RGS7, SSH1, phosphorylated CDKN1B, GAB2, phosphorylated PDPK1, and phosphorylated DAPK2. 14-3-3 theta Protein, Human (His) is the recombinant human-derived 14-3-3 theta protein, expressed by E. coli , with N-6His labeled tag.

Product Specifications

Product Name Alternative

14-3-3 theta Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/14-3-3-theta-protein-human-his.html

Purity

98.0

Smiles

MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN

Molecular Formula

10971 (Gene_ID) P27348 (M1-N245) (Accession)

Molecular Weight

Approximately 29 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LAX1 Overexpression Lysate (Native) - (Dry Ice)
NBP2-06919 0.1 mg

LAX1 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
Recombinant TIMP1 Antibody
V3595-100UG 100 µg

Recombinant TIMP1 Antibody

Sign In for Pricing
View Details
Smad3 (pT179) Antibody
abx011534 100 µg

Smad3 (pT179) Antibody

Sign In for Pricing
View Details
pCMV-SPORT6-GOLGA3 Plasmid
PVT33716 2 µg

pCMV-SPORT6-GOLGA3 Plasmid

Sign In for Pricing
View Details
CNTN6 protein, Human, Recombinant (His)
E51P90462 20 µg

CNTN6 protein, Human, Recombinant (His)

Sign In for Pricing
View Details
pDNR-LIB-Rpl39 Plasmid
PVT42036 2 µg

pDNR-LIB-Rpl39 Plasmid

Sign In for Pricing
View Details