Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

14-3-3 theta, Human (His)

14-3-3 theta proteins are adapters in multiple signaling pathways that recognize phosphoserine or phosphothreonine motifs and modulate chaperone activity upon binding. It negatively regulates PDPK1 kinase activity, forms homodimers, and interacts with CDK16, phosphorylated RGS7, SSH1, phosphorylated CDKN1B, GAB2, phosphorylated PDPK1, and phosphorylated DAPK2. 14-3-3 theta Protein, Human (His) is the recombinant human-derived 14-3-3 theta protein, expressed by E. coli , with N-6His labeled tag.

Product Specifications

Product Name Alternative

14-3-3 theta Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/14-3-3-theta-protein-human-his.html

Purity

98.0

Smiles

MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN

Molecular Formula

10971 (Gene_ID) P27348 (M1-N245) (Accession)

Molecular Weight

Approximately 29 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bordetella Avium rpsK Protein (aa 1-133)
VAng-Lsx4122-50gEcoli 50 µg (E. coli)

Recombinant Bordetella Avium rpsK Protein (aa 1-133)

Sign In for Pricing
View Details
Lentiviral human FAM76A shRNA (UAS) - Lentiviral human FAM76A shRNA (UAS, GFP) plasmid
GTR15129082 1 Vial

Lentiviral human FAM76A shRNA (UAS) - Lentiviral human FAM76A shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Gxylt2 Rat Pre-designed siRNA Set A
HY-RS28380 1 Set

Gxylt2 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
CHMP3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV678088 1.0 µg DNA

CHMP3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon
CS814409 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details
Anti-NPTII Mouse mAb
MBS8533150-01 0.1 mL

Anti-NPTII Mouse mAb

Sign In for Pricing
View Details