Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

14-3-3 theta, Human (His)

14-3-3 theta proteins are adapters in multiple signaling pathways that recognize phosphoserine or phosphothreonine motifs and modulate chaperone activity upon binding. It negatively regulates PDPK1 kinase activity, forms homodimers, and interacts with CDK16, phosphorylated RGS7, SSH1, phosphorylated CDKN1B, GAB2, phosphorylated PDPK1, and phosphorylated DAPK2. 14-3-3 theta Protein, Human (His) is the recombinant human-derived 14-3-3 theta protein, expressed by E. coli , with N-6His labeled tag.

Product Specifications

Product Name Alternative

14-3-3 theta Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/14-3-3-theta-protein-human-his.html

Purity

98.0

Smiles

MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN

Molecular Formula

10971 (Gene_ID) P27348 (M1-N245) (Accession)

Molecular Weight

Approximately 29 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRO Antibody, HRP conjugated
A37555-50UL 50 μL

TRO Antibody, HRP conjugated

Sign In for Pricing
View Details
Recombinant Mouse ADAM10 CF
946-AD-020 20 µg

Recombinant Mouse ADAM10 CF

Sign In for Pricing
View Details
Human VASH1 (Vasohibin 1) ELISA Kit
EH24480 96 Tests

Human VASH1 (Vasohibin 1) ELISA Kit

Sign In for Pricing
View Details
Importin alpha 3/KPNA4 Blocking Peptide
NBP1-76300PEP 0.05 mg

Importin alpha 3/KPNA4 Blocking Peptide

Sign In for Pricing
View Details
ANXA8L2 (NM_001630) Human Untagged Clone
SC119166 10 µg

ANXA8L2 (NM_001630) Human Untagged Clone

Sign In for Pricing
View Details
Lentiviral mouse Cdc42se1 shRNA (UAS) - Lentiviral mouse Cdc42se1 shRNA (UAS, GFP) plasmid
GTR15197398 1 Vial

Lentiviral mouse Cdc42se1 shRNA (UAS) - Lentiviral mouse Cdc42se1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details