Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

14-3-3 theta, Human (His)

14-3-3 theta proteins are adapters in multiple signaling pathways that recognize phosphoserine or phosphothreonine motifs and modulate chaperone activity upon binding. It negatively regulates PDPK1 kinase activity, forms homodimers, and interacts with CDK16, phosphorylated RGS7, SSH1, phosphorylated CDKN1B, GAB2, phosphorylated PDPK1, and phosphorylated DAPK2. 14-3-3 theta Protein, Human (His) is the recombinant human-derived 14-3-3 theta protein, expressed by E. coli , with N-6His labeled tag.

Product Specifications

Product Name Alternative

14-3-3 theta Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/14-3-3-theta-protein-human-his.html

Purity

98.0

Smiles

MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN

Molecular Formula

10971 (Gene_ID) P27348 (M1-N245) (Accession)

Molecular Weight

Approximately 29 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL7AP28 siRNA Oligos set (Human)
41803171 3x 5 nmol

RPL7AP28 siRNA Oligos set (Human)

Sign In for Pricing
View Details
PRRT4 Protein Vector (Mouse) (pPM-C-His)
PV219977 500 ng

PRRT4 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
FMN2 Rabbit Polyclonal Antibody
E53P09941 100 µL

FMN2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Defb7 shRNA (UAS) - Lentiviral mouse Defb7 shRNA (UAS, RFP) plasmid
GTR15138913 1 Vial

Lentiviral mouse Defb7 shRNA (UAS) - Lentiviral mouse Defb7 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
4930503B20Rik (NM_029144) Mouse Tagged ORF Clone Lentiviral Particle
MR202666L4V 200 µL

4930503B20Rik (NM_029144) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Spermine Synthase (SMS) Antibody (Biotin)
abx314337-01 20 µg

Spermine Synthase (SMS) Antibody (Biotin)

Sign In for Pricing
View Details