Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

14-3-3 theta, Human (His)

14-3-3 theta proteins are adapters in multiple signaling pathways that recognize phosphoserine or phosphothreonine motifs and modulate chaperone activity upon binding. It negatively regulates PDPK1 kinase activity, forms homodimers, and interacts with CDK16, phosphorylated RGS7, SSH1, phosphorylated CDKN1B, GAB2, phosphorylated PDPK1, and phosphorylated DAPK2. 14-3-3 theta Protein, Human (His) is the recombinant human-derived 14-3-3 theta protein, expressed by E. coli , with N-6His labeled tag.

Product Specifications

Product Name Alternative

14-3-3 theta Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/14-3-3-theta-protein-human-his.html

Purity

98.0

Smiles

MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN

Molecular Formula

10971 (Gene_ID) P27348 (M1-N245) (Accession)

Molecular Weight

Approximately 29 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SESN3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2127407 1.0 µg DNA

SESN3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Anti-ATP6V1F antibody
PAab00724 100 µg

Anti-ATP6V1F antibody

Sign In for Pricing
View Details
TRPC5, NT (TRPC5, TRP5, Short transient receptor potential channel 5, Transient receptor protein 5) (FITC) discontinued
043288-FITC 200 µL

TRPC5, NT (TRPC5, TRP5, Short transient receptor potential channel 5, Transient receptor protein 5) (FITC) discontinued

Sign In for Pricing
View Details
Lentiviral mouse Ctsk shRNA (UAS) - Lentiviral mouse Ctsk shRNA (UAS) (100)
GTR15145902 1 Vial

Lentiviral mouse Ctsk shRNA (UAS) - Lentiviral mouse Ctsk shRNA (UAS) (100)

Sign In for Pricing
View Details
Rabbit Polyclonal TRIM37 Antibody
NBP2-98830-50ul 50 µL

Rabbit Polyclonal TRIM37 Antibody

Sign In for Pricing
View Details
Fasudil hydrochloride
abx185977-01 5 g

Fasudil hydrochloride

Sign In for Pricing
View Details