Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

14-3-3 theta, Human (His)

14-3-3 theta proteins are adapters in multiple signaling pathways that recognize phosphoserine or phosphothreonine motifs and modulate chaperone activity upon binding. It negatively regulates PDPK1 kinase activity, forms homodimers, and interacts with CDK16, phosphorylated RGS7, SSH1, phosphorylated CDKN1B, GAB2, phosphorylated PDPK1, and phosphorylated DAPK2. 14-3-3 theta Protein, Human (His) is the recombinant human-derived 14-3-3 theta protein, expressed by E. coli , with N-6His labeled tag.

Product Specifications

Product Name Alternative

14-3-3 theta Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/14-3-3-theta-protein-human-his.html

Purity

98.0

Smiles

MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN

Molecular Formula

10971 (Gene_ID) P27348 (M1-N245) (Accession)

Molecular Weight

Approximately 29 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP6V0B, ID (ATP6V0B, ATP6F, V-type proton ATPase 21kD proteolipid subunit, Vacuolar proton pump 21kD proteolipid subunit, hATPL) (MaxLight 750) discontinued
032294-ML750 100 µL

ATP6V0B, ID (ATP6V0B, ATP6F, V-type proton ATPase 21kD proteolipid subunit, Vacuolar proton pump 21kD proteolipid subunit, hATPL) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Anti-GM2 ganglioside [KM966]
MBS489026-01 0.2 mg

Anti-GM2 ganglioside [KM966]

Sign In for Pricing
View Details
Anti-GM2 ganglioside [KM966]
MBS489026-02 5x 0.2 mg

Anti-GM2 ganglioside [KM966]

Sign In for Pricing
View Details
Mouse Monoclonal Complement C3a Antibody (K13/16-5.7) [Alexa Fluor 350]
NBP1-05122AF350 0.1 mL

Mouse Monoclonal Complement C3a Antibody (K13/16-5.7) [Alexa Fluor 350]

Sign In for Pricing
View Details
D-Raffinose pentahydrate 99% For Biochemistry
02246 00010 10 g

D-Raffinose pentahydrate 99% For Biochemistry

Sign In for Pricing
View Details
6-[10 (Z) -heptadecenyl]salicylic acid
RG-E140489-01 10 mg

6-[10 (Z) -heptadecenyl]salicylic acid

Sign In for Pricing
View Details