Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

14-3-3 theta, Human (His)

14-3-3 theta proteins are adapters in multiple signaling pathways that recognize phosphoserine or phosphothreonine motifs and modulate chaperone activity upon binding. It negatively regulates PDPK1 kinase activity, forms homodimers, and interacts with CDK16, phosphorylated RGS7, SSH1, phosphorylated CDKN1B, GAB2, phosphorylated PDPK1, and phosphorylated DAPK2. 14-3-3 theta Protein, Human (His) is the recombinant human-derived 14-3-3 theta protein, expressed by E. coli , with N-6His labeled tag.

Product Specifications

Product Name Alternative

14-3-3 theta Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/14-3-3-theta-protein-human-his.html

Purity

98.0

Smiles

MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN

Molecular Formula

10971 (Gene_ID) P27348 (M1-N245) (Accession)

Molecular Weight

Approximately 29 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Free Protein S (FPS) ELISA Kit
EIA05682m 1 Kit

Mouse Free Protein S (FPS) ELISA Kit

Sign In for Pricing
View Details
DUPD1 CRISPR Activation Plasmid (m)
sc-436709-ACT 20 µg

DUPD1 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Mouse M6pr qPCR Primer Pair
QM16566S 200 Tests

Mouse M6pr qPCR Primer Pair

Sign In for Pricing
View Details
C-erbB2 (HER-2, neu Receptor) (BSA & Azide Free) (PE) discontinued
C0026-11QX-PE 100 µL

C-erbB2 (HER-2, neu Receptor) (BSA & Azide Free) (PE) discontinued

Sign In for Pricing
View Details
FGFR2 (NM_001144914) Human Tagged Lenti ORF Clone
RC227087L3 10 µg

FGFR2 (NM_001144914) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Adenine (6-Aminopurine; Vitamin B4) Plant Culture Tested
PCT1842-01 5 g

Adenine (6-Aminopurine; Vitamin B4) Plant Culture Tested

Sign In for Pricing
View Details