Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

14-3-3 theta, Human (His)

14-3-3 theta proteins are adapters in multiple signaling pathways that recognize phosphoserine or phosphothreonine motifs and modulate chaperone activity upon binding. It negatively regulates PDPK1 kinase activity, forms homodimers, and interacts with CDK16, phosphorylated RGS7, SSH1, phosphorylated CDKN1B, GAB2, phosphorylated PDPK1, and phosphorylated DAPK2. 14-3-3 theta Protein, Human (His) is the recombinant human-derived 14-3-3 theta protein, expressed by E. coli , with N-6His labeled tag.

Product Specifications

Product Name Alternative

14-3-3 theta Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/14-3-3-theta-protein-human-his.html

Purity

98.0

Smiles

MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN

Molecular Formula

10971 (Gene_ID) P27348 (M1-N245) (Accession)

Molecular Weight

Approximately 29 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAMP3 Double Nickase Plasmid (m)
sc-425003-NIC 20 µg

RAMP3 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Recombinant Human ZNF146 Protein
E30P12193 20 µg

Recombinant Human ZNF146 Protein

Sign In for Pricing
View Details
RSU1P1 CRISPR Knock Out 293T Cell Line (Human)
42807141 1x 10^6 Cells / 1.0 mL

RSU1P1 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Ptms sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4842302 1.0 µg DNA

Ptms sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
BMI-1, CT (Polycomb Complex Protein BMI-1, Polycomb Group RING Finger Protein 4, RING Finger Protein 51, BMI1, PCGF4, RNF51) (MaxLight 550)
MBS6465435-01 0.1 mL

BMI-1, CT (Polycomb Complex Protein BMI-1, Polycomb Group RING Finger Protein 4, RING Finger Protein 51, BMI1, PCGF4, RNF51) (MaxLight 550)

Sign In for Pricing
View Details
BMI-1, CT (Polycomb Complex Protein BMI-1, Polycomb Group RING Finger Protein 4, RING Finger Protein 51, BMI1, PCGF4, RNF51) (MaxLight 550)
MBS6465435-02 5x 0.1 mL

BMI-1, CT (Polycomb Complex Protein BMI-1, Polycomb Group RING Finger Protein 4, RING Finger Protein 51, BMI1, PCGF4, RNF51) (MaxLight 550)

Sign In for Pricing
View Details