Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

14-3-3 theta, Human (His)

14-3-3 theta proteins are adapters in multiple signaling pathways that recognize phosphoserine or phosphothreonine motifs and modulate chaperone activity upon binding. It negatively regulates PDPK1 kinase activity, forms homodimers, and interacts with CDK16, phosphorylated RGS7, SSH1, phosphorylated CDKN1B, GAB2, phosphorylated PDPK1, and phosphorylated DAPK2. 14-3-3 theta Protein, Human (His) is the recombinant human-derived 14-3-3 theta protein, expressed by E. coli , with N-6His labeled tag.

Product Specifications

Product Name Alternative

14-3-3 theta Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/14-3-3-theta-protein-human-his.html

Purity

98.0

Smiles

MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN

Molecular Formula

10971 (Gene_ID) P27348 (M1-N245) (Accession)

Molecular Weight

Approximately 29 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAST Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV680127 1.0 µg DNA

CAST Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
RPS17P16 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2037306 1.0 µg DNA

RPS17P16 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
ZNF90 Adenovirus (Human)
51911051 1.0 mL

ZNF90 Adenovirus (Human)

Sign In for Pricing
View Details
G-1 10mg
A19310-10 10 mg

G-1 10mg

Sign In for Pricing
View Details
MORF4L2 Protein Vector (Mouse) (pPB-C-His)
PV201562 500 ng

MORF4L2 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
PP Storage Box for 12mm Vials
CHR2170 1 Each

PP Storage Box for 12mm Vials

Sign In for Pricing
View Details