Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast growth factor 23 (FGF23), partial

Product Specifications

Product Name Alternative

FGF-23; Phosphatonin; Tumor-derived hypophosphatemia-inducing factor

Abbreviation

Recombinant Human FGF23 protein, partial

Gene Name

FGF23

UniProt

Q9GZV9

Expression Region

180-251aa

Organism

Homo sapiens (Human)

Target Sequence

SAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Relevance

Regulator of phosphate homeostasis. Inhibits renal tubular phosphate transport by reducing SLC34A1 levels. Up-regulates EGR1 expression in the presence of KL (By similarity) . Acts directly on the parathyroid to decrease PTH secretion. Regulator of vitamin-D metabolism . Negatively regulates osteoblast differentiation and matrix mineralization.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Bioactivity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

14.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

8- Bromoadenosine- 2', 3'- cyclic monophosphorothioate, exo / Sp- isomer (Sp-8-Br-2',3'-cAMPS), sodium salt
B 268-05 5 µmol ~ 2.2 mg

8- Bromoadenosine- 2', 3'- cyclic monophosphorothioate, exo / Sp- isomer (Sp-8-Br-2',3'-cAMPS), sodium salt

Sign In for Pricing
View Details
Bovine Desmosine, DES ELISA KIT
E0228Bo-01 48 Well

Bovine Desmosine, DES ELISA KIT

Sign In for Pricing
View Details
Bovine Desmosine, DES ELISA KIT
E0228Bo-02 96 Well

Bovine Desmosine, DES ELISA KIT

Sign In for Pricing
View Details
Bovine Desmosine, DES ELISA KIT
E0228Bo-03 5x 96 Tests

Bovine Desmosine, DES ELISA KIT

Sign In for Pricing
View Details
Bovine Desmosine, DES ELISA KIT
E0228Bo-04 10x 96 Tests

Bovine Desmosine, DES ELISA KIT

Sign In for Pricing
View Details
Porcine AT rich interactive domain containing protein 3C (ARID3C) ELISA Kit
GTR10338561 96 Well

Porcine AT rich interactive domain containing protein 3C (ARID3C) ELISA Kit

Sign In for Pricing
View Details