Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-12 beta, Rabbit (HEK293, His)

IL-12 beta Protein, also known as natural killer cell stimulatory factor 2, is a common subunit (p40) of IL-12 and IL-23. IL-12 is a inflammatory factor expressed by activated macrophages, and involves in Th1-type immune response against cancer[1]. IL-12 beta Protein located outside the cell membrane, involves in singalling mediated by Jak-STAT[3]. IL-12 beta Protein consists of 335 amino acids (M1-N324) with a fibronectin type-III domain (233-324 a.a) . IL-12 beta Protein, Rabbit is produced in HEK293 cells with a C-Terminal His-tag.

Product Specifications

Product Name Alternative

IL-12 beta Protein, Rabbit (HEK293, His), Rabbit, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-12-beta-protein-rabbit-hek293-his.html

Purity

98.00

Smiles

IWELEKDVYVVELDWYPDAPGETVVLTCDTSEEDGITWTSEQSNKVLGSGKTLTILVKEFGDAGQYTCHKGDKVLGHSKVLLHKKEDGIWSTDILKDQKEPKSKTFLKCEAKNYSGHFTCWWLTAISRDVKFSVKSNRGSSDPQGVTCGVPERVSVNHTEYKYSVECQEDNACPAAEESLHLEVMLDAIHKLKYENYTSSFFIRDIIKPDPPQNLQMKPLKNSRHVEVSWEYPDTWSTPHSYFSLTFCVQVQNKNKKEKKDRLCVDKTSATVMCHKDAKIRVQARDRYYSSSWSEWAFVSCN

Molecular Formula

100354852 (Gene_ID) G1TBD7/XP_002710393.1 (I23-N324) (Accession)

Molecular Weight

Approximately 40-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Lu X. Impact of IL-12 in Cancer. Curr Cancer Drug Targets. 2017;17 (8) :682-697.|[2]Gunsten S, et al. IL-12 p80-dependent macrophage recruitment primes the host for increased survival following a lethal respiratory viral infection. Immunology. 2009 Apr;126 (4) :500-13.|[3]Gotthardt D, Trifinopoulos J, Sexl V, Putz EM. JAK/STAT Cytokine Signaling at the Crossroad of NK Cell Development and Maturation. Front Immunol. 2019 Nov 12;10:2590.|[4]Tait Wojno ED, Hunter CA, Stumhofer JS. The Immunobiology of the Interleukin-12 Family: Room for Discovery. Immunity. 2019 Apr 16;50 (4) :851-870.|[5]Subbian S, et al. Molecular immunologic correlates of spontaneous latency in a rabbit model of pulmonary tuberculosis. Cell Commun Signal. 2013 Feb 28;11 (1) :16.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spata7 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6964803 1.0 µg DNA

Spata7 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
PPP2R1A (Serine/Threonine-Protein Phosphatase 2A 65kD Regulatory Subunit A alpha Isoform, PP2A Subunit A Isoform PR65-alpha, PP2A Subunit A Isoform R1-alpha, Medium Tumor Antigen-associated 61kD Protein, MGC786) (APC)
131709-APC 100 µL

PPP2R1A (Serine/Threonine-Protein Phosphatase 2A 65kD Regulatory Subunit A alpha Isoform, PP2A Subunit A Isoform PR65-alpha, PP2A Subunit A Isoform R1-alpha, Medium Tumor Antigen-associated 61kD Protein, MGC786) (APC)

Sign In for Pricing
View Details
TGIF2 (TGFB-Induced Factor Homeobox 2) (Biotin)
MBS6172693-01 0.1 mL

TGIF2 (TGFB-Induced Factor Homeobox 2) (Biotin)

Sign In for Pricing
View Details
TGIF2 (TGFB-Induced Factor Homeobox 2) (Biotin)
MBS6172693-02 5x 0.1 mL

TGIF2 (TGFB-Induced Factor Homeobox 2) (Biotin)

Sign In for Pricing
View Details
GW 7647 100mg
A11982-100 100 mg

GW 7647 100mg

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Aspartate Beta Hydroxylase (ASPH)
MBS2148787-01 0.1 mL

PE-Linked Monoclonal Antibody to Aspartate Beta Hydroxylase (ASPH)

Sign In for Pricing
View Details