Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-12 beta, Rabbit (HEK293, His)

IL-12 beta Protein, also known as natural killer cell stimulatory factor 2, is a common subunit (p40) of IL-12 and IL-23. IL-12 is a inflammatory factor expressed by activated macrophages, and involves in Th1-type immune response against cancer[1]. IL-12 beta Protein located outside the cell membrane, involves in singalling mediated by Jak-STAT[3]. IL-12 beta Protein consists of 335 amino acids (M1-N324) with a fibronectin type-III domain (233-324 a.a) . IL-12 beta Protein, Rabbit is produced in HEK293 cells with a C-Terminal His-tag.

Product Specifications

Product Name Alternative

IL-12 beta Protein, Rabbit (HEK293, His), Rabbit, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-12-beta-protein-rabbit-hek293-his.html

Purity

98.00

Smiles

IWELEKDVYVVELDWYPDAPGETVVLTCDTSEEDGITWTSEQSNKVLGSGKTLTILVKEFGDAGQYTCHKGDKVLGHSKVLLHKKEDGIWSTDILKDQKEPKSKTFLKCEAKNYSGHFTCWWLTAISRDVKFSVKSNRGSSDPQGVTCGVPERVSVNHTEYKYSVECQEDNACPAAEESLHLEVMLDAIHKLKYENYTSSFFIRDIIKPDPPQNLQMKPLKNSRHVEVSWEYPDTWSTPHSYFSLTFCVQVQNKNKKEKKDRLCVDKTSATVMCHKDAKIRVQARDRYYSSSWSEWAFVSCN

Molecular Formula

100354852 (Gene_ID) G1TBD7/XP_002710393.1 (I23-N324) (Accession)

Molecular Weight

Approximately 40-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Lu X. Impact of IL-12 in Cancer. Curr Cancer Drug Targets. 2017;17 (8) :682-697.|[2]Gunsten S, et al. IL-12 p80-dependent macrophage recruitment primes the host for increased survival following a lethal respiratory viral infection. Immunology. 2009 Apr;126 (4) :500-13.|[3]Gotthardt D, Trifinopoulos J, Sexl V, Putz EM. JAK/STAT Cytokine Signaling at the Crossroad of NK Cell Development and Maturation. Front Immunol. 2019 Nov 12;10:2590.|[4]Tait Wojno ED, Hunter CA, Stumhofer JS. The Immunobiology of the Interleukin-12 Family: Room for Discovery. Immunity. 2019 Apr 16;50 (4) :851-870.|[5]Subbian S, et al. Molecular immunologic correlates of spontaneous latency in a rabbit model of pulmonary tuberculosis. Cell Commun Signal. 2013 Feb 28;11 (1) :16.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANP32C Human Gene Knockout Kit (CRISPR)
KN415880 1 Kit

ANP32C Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PAD4, CT (Protein-arginine Deiminase Type IV, Protein-arginine Deiminase Type-4, Peptidylarginine Deiminase IV, HL-60 PAD, PADI4, PADI5, PDI5) (MaxLight 550)
MBS6491720-01 0.1 mL

PAD4, CT (Protein-arginine Deiminase Type IV, Protein-arginine Deiminase Type-4, Peptidylarginine Deiminase IV, HL-60 PAD, PADI4, PADI5, PDI5) (MaxLight 550)

Sign In for Pricing
View Details
PAD4, CT (Protein-arginine Deiminase Type IV, Protein-arginine Deiminase Type-4, Peptidylarginine Deiminase IV, HL-60 PAD, PADI4, PADI5, PDI5) (MaxLight 550)
MBS6491720-02 5x 0.1 mL

PAD4, CT (Protein-arginine Deiminase Type IV, Protein-arginine Deiminase Type-4, Peptidylarginine Deiminase IV, HL-60 PAD, PADI4, PADI5, PDI5) (MaxLight 550)

Sign In for Pricing
View Details
CTNNA1 (Catenin alpha-1, Cadherin-associated Protein, CAP102) (HRP)
MBS6412849-01 0.1 mL

CTNNA1 (Catenin alpha-1, Cadherin-associated Protein, CAP102) (HRP)

Sign In for Pricing
View Details
CTNNA1 (Catenin alpha-1, Cadherin-associated Protein, CAP102) (HRP)
MBS6412849-02 5x 0.1 mL

CTNNA1 (Catenin alpha-1, Cadherin-associated Protein, CAP102) (HRP)

Sign In for Pricing
View Details
pLV3-U6-Cdkn1a-shRNA2-Puro Plasmid
PVT59955 2 µg

pLV3-U6-Cdkn1a-shRNA2-Puro Plasmid

Sign In for Pricing
View Details