TPO/Thrombopoietin, Human (HEK293, C/N-His)
TPO/Thrombopoietin Protein, Human (HEK 293, His) is a recombinant protein produced in HEK293 cells with a His tag. TPO is a growth factor for the megakaryocytic/platelet lineage.
Product Specifications
Product Name Alternative
TPO/Thrombopoietin Protein, Human (HEK293, C/N-His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/tpo-protein-human-hek-293-his.html
Purity
98.0
Smiles
SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG
Molecular Formula
7066 (Gene_ID) P40225-1 (S22-G353) (Accession)
Molecular Weight
Approximately 70-90 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Li L, et al. c-Mpl and TPO expression in the human central nervous system neurons inhibits neuronal apoptosis. Aging (Albany NY) . 2020;12 (8) :7397-7410.|[2]El Shabrawy RM, et al. Serum Anti-TPO and TPO Gene Polymorphism as a Predictive Factor for Hidden Autoimmune Thyroiditis in Patient with Bronchial Asthma and Allergic Rhinitis. Egypt J Immunol. 2016;23 (1) :77-86.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC941820-500 1x 500 µL
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470270-500 1x 500 µL
Fibronectin (HFN7.1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740859-100 1x 100 µL
Human Kappa Light Chain (Kap-56), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details