Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPY, Human (HEK293, His)

NPY protein is related to feeding behavior and GnRH secretion, and plays a crucial role in complex neural circuits that control appetite and energy balance. Its effects on GnRH secretion suggest a multifaceted role in the interplay between neural and endocrine pathways, particularly during reproduction. NPY Protein, Human (HEK293, His) is the recombinant human-derived NPY protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

NPY Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/npy-protein-human-hek-293-his.html

Purity

98.0

Smiles

YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW

Molecular Formula

4852 (Gene_ID) P01303 (Y29-W97) (Accession)

Molecular Weight

Approximately 13.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD54 / ICAM-1 (15.2), CF740 conjugate, 0.1mg/mL
BNC742853-100 1x 100 µL

CD54 / ICAM-1 (15.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF555 conjugate, 0.1mg/mL
BNC550333-100 1x 100 µL

CD8 (RIV11), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF594 conjugate, 0.1mg/mL
BNC941429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF555 conjugate, 0.1mg/mL
BNC550645-500 1x 500 µL

FOXP3 (3G3), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (KRT17/778), CF647 conjugate, 0.1mg/mL
BNC470778-100 1x 100 µL

Cytokeratin 17 (KRT17/778), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD66 (CEA) (C66/261), CF594 conjugate, 0.1mg/mL
BNC940261-500 1x 500 µL

CD66 (CEA) (C66/261), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details