Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Monoclonal Antibody to Creatine Kinase B (CK-BB)

Product Specifications

Gene Name

[CK-BB]

NCBI Gene ID

24264

Reactivity

Rat, Human, Pig

Storage Conditions

Store at 4 degree C for frequent use. Store at -20 degree C in a manual defrost freezer for two year without detectable loss of activity. Avoid repeated freeze-thaw cycles.<br>The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 degree C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.

Specificity

The antibody is a mouse monoclonal antibody raised against CK-BB. It has been selected for its ability to recognize CK-BB in immunohistochemical staining and western blotting.

Other Gene Names

[Ckb; Ckb; Ckbb; Ckbr; Ckbb]

Short Name

[Creatine Kinase B (CK-BB)]

Other Product Names

[creatine kinase B-type; Creatine kinase B-type; creatine kinase B-type; B-CK; brain creatine kinase; creatine kinase B chain; creatine kinase, brain; B-CK; Creatine kinase B chain]

NCBI GI Number

401461784

NCBI Accession Number

NP_036661.3

NCBI GB Accession Number

NM_012529.3

Uniprot Accession Number

P07335

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
MF-0155578-01 5 mg

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Sign In for Pricing
View Details
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
MF-0155578-02 50 mg

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Sign In for Pricing
View Details
Recombinant Tyrosine recombinase XerC-like (sss)
MBS1366965-01 0.02 mg (E-Coli)

Recombinant Tyrosine recombinase XerC-like (sss)

Sign In for Pricing
View Details
Recombinant Tyrosine recombinase XerC-like (sss)
MBS1366965-02 0.02 mg (Yeast)

Recombinant Tyrosine recombinase XerC-like (sss)

Sign In for Pricing
View Details
Recombinant Tyrosine recombinase XerC-like (sss)
MBS1366965-03 0.1 mg (E-Coli)

Recombinant Tyrosine recombinase XerC-like (sss)

Sign In for Pricing
View Details
Recombinant Tyrosine recombinase XerC-like (sss)
MBS1366965-04 0.1 mg (Yeast)

Recombinant Tyrosine recombinase XerC-like (sss)

Sign In for Pricing
View Details