Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Eotaxin protein (Ccl11) (Active)

Product Specifications

Product Name Alternative

C-C motif chemokine 11, Small-inducible cytokine A11

Abbreviation

Recombinant Mouse Ccl11 protein (Active)

Gene Name

Ccl11

UniProt

P48298

Expression Region

24-97aa

Organism

Mus musculus (Mouse)

Target Sequence

HPGSIPTSCCFIMTSKKIPNTLLKSYKRITNNRCTLKAIVFKTRLGKEICADPKKKWVQDATKHLDQKLQTPKP

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.Coli

Field of Research

Immunology

Relevance

In response to the presence of allergens, this protein directly promotes the accumulation of eosinophils (a prominent feature of allergic inflammatory reactions), but not lymphocytes, macrophages or neutrophils.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

>96% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using purified eosinophils is in a concentration range of 100-1000 ng/ml.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 µm filtered PBS, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

In response to the presence of allergens, this protein directly promotes the accumulation of eosinophils (a prominent feature of allergic inflammatory reactions), but not lymphocytes, macrophages or neutrophils.

Molecular Weight

8.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal Antibody to Ras Homolog Gene Family, Member A (RHOA)
TRV-0059685-01 20 µL

Monoclonal Antibody to Ras Homolog Gene Family, Member A (RHOA)

Sign In for Pricing
View Details
Monoclonal Antibody to Ras Homolog Gene Family, Member A (RHOA)
TRV-0059685-02 100 µL

Monoclonal Antibody to Ras Homolog Gene Family, Member A (RHOA)

Sign In for Pricing
View Details
Monoclonal Antibody to Ras Homolog Gene Family, Member A (RHOA)
TRV-0059685-03 200 µL

Monoclonal Antibody to Ras Homolog Gene Family, Member A (RHOA)

Sign In for Pricing
View Details
Monoclonal Antibody to Ras Homolog Gene Family, Member A (RHOA)
TRV-0059685-04 1 mL

Monoclonal Antibody to Ras Homolog Gene Family, Member A (RHOA)

Sign In for Pricing
View Details
CSRP2 Antibody Pair
MBS7041902-01 1 Pair (Sufficient for 5x96 well plates)

CSRP2 Antibody Pair

Sign In for Pricing
View Details
CSRP2 Antibody Pair
MBS7041902-02 5x 1 Pair (Sufficient for 25x 96 Well Plates)

CSRP2 Antibody Pair

Sign In for Pricing
View Details